Recombinant Human ATG4A protein, GST-tagged

• Cat.No.: ATG4A-948H
• Product Overview: Human ATG4A full-length ORF ( NP_443168.2, 1 a.a. - 398 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Autophagy is the process by which endogenous proteins and damaged organelles are destroyed intracellularly. Autophagy is postulated to be essential for cell homeostasis and cell remodeling during differentiation, metamorphosis, non-apoptotic cell death, and aging. Reduced levels of autophagy have been described in some malignant tumors, and a role for autophagy in controlling the unregulated cell growth linked to cancer has been proposed. This gene encodes a member of the autophagin protein family. The encoded protein is also designated as a member of the C-54 family of cysteine proteases. [provided by RefSeq, Mar 2016]
• Molecular Mass: 71.8 kDa
• AA Sequence: MESVLSKYEDQITIFTDYLEEYPDTDELVWILGKQHLLKTEKSKLLSDISARLWFTYRRKFSPIGGTGPSSDAGWGCMLRCGQMMLAQALICRHLGRDWSWEKQKEQPKEYQRILQCFLDRKDCCYSIHQMAQMGVGEGKSIGEWFGPNTVAQVLKKLALFDEWNSLAVYVSMDNTVVIEDIKKMCRVLPLSADTAGDRPPDSLTASNQSKGTSAYCSAWKPLLLIVPLRLGINQINPVYVDAFKECFKMPQSLGALGGKPNNAYYFIGFLGDELIFLDPHTTQTFVDTEENGTVNDQTFHCLQSPQRMNILNLDPSVALGFFCKEEKDFDNWCSLVQKEILKENLRMFELVQKHPSHWPPFVPPAKPEVTTTGAEFIDSTEQLEEFDLEEDFEILSV
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ATG4A ATG4 autophagy related 4 homolog A (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: ATG4A
• Synonyms: ATG4A; ATG4 autophagy related 4 homolog A (S. cerevisiae); APG4 autophagy 4 homolog A (S. cerevisiae) , APG4A, AUT like 2, cysteine endopeptidase (S. cerevisiae) , AUTL2; cysteine protease ATG4A; hAPG4A; autophagin 2; autophagin-2; APG4 autophagy 4 homolog A; AUT-like 2 cysteine endopeptidase; AUT-like 2, cysteine endopeptidase; autophagy-related protein 4 homolog A; autophagy-related cysteine endopeptidase 2; APG4A; AUTL2
• Gene ID: 115201
• mRNA Refseq: NM_052936
• Protein Refseq: NP_443168
• MIM: 300663
• UniProt ID: Q8WYN0