Recombinant Human ATG4A, His-tagged
Cat.No. : | ATG4A-36H |
Product Overview : | Recombinant Human Cysteine Protease ATG4A/ATG4A is produced with our E. coli expression system. The target protein is expressed with sequence (Met1-Val398) of Human ATG4A fused with a 6His tag at the N-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-398 a.a. |
Description : | Cysteine Protease ATG4A (ATG4A) is a cytoplasmic protein that belongs to the peptidase C54 family. ATG4A is widely expressed in many tissues at a low level, but the highest expression is observed in skeletal muscle and brain. ATG4A is a cysteine protease required for autophagy; it cleaves the C-terminal part of MAP1LC3, GABARAPL2 or GABARAP. ATG4A is inhibited by N-ethylmaleimide. It is suggested that ATG4A has a significant role in suppressing various cancers. |
Form : | Supplied as a 0.2 μM filtered solution of PBS, pH 7.4 |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMESVLSKYEDQITIFTDYLEEYPDTDELVWILGKQHLLKTEKSKL LSDISARLWFTYRRKFSPIGGTGPSSDAGWGCMLRCGQMMLAQALICRHLGRDWSWEKQKEQPKE YQRILQCFLDRKDCCYSIHQMAQMGVGEGKSIGEWFGPNTVAQVLKKLALFDEWNSLAVYVSMDN TVVIEDIKKMCRVLPLSADTAGDRPPDSLTASNQSKGTSAYCSAWKPLLLIVPLRLGINQINPVY VDAFKECFKMPQSLGALGGKPNNAYYFIGFLGDELIFLDPHTTQTFVDTEENGTVNDQTFHCLQS PQRMNILNLDPSVALGFFCKEEKDFDNWCSLVQKEILKENLRMFELVQKHPSHWPPFVPPAKPEV TTTGAEFIDSTEQLEEFDLEEDFEILSV |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Storage : | Store at Please minimize freeze-thaw cycles. |
Gene Name | ATG4A ATG4 autophagy related 4 homolog A (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | ATG4A |
Synonyms | ATG4A; ATG4 autophagy related 4 homolog A (S. cerevisiae); APG4 autophagy 4 homolog A (S. cerevisiae) , APG4A, AUT like 2, cysteine endopeptidase (S. cerevisiae) , AUTL2; cysteine protease ATG4A; hAPG4A; autophagin 2; autophagin-2; APG4 autophagy 4 homolog A; AUT-like 2 cysteine endopeptidase; AUT-like 2, cysteine endopeptidase; autophagy-related protein 4 homolog A; autophagy-related cysteine endopeptidase 2; APG4A; AUTL2; |
Gene ID | 115201 |
mRNA Refseq | NM_052936 |
Protein Refseq | NP_443168 |
MIM | 300663 |
UniProt ID | Q8WYN0 |
Chromosome Location | Xq22.1-q22.3 |
Pathway | Regulation of autophagy, organism-specific biosystem; Regulation of autophagy, conserved biosystem; |
Function | cysteine-type peptidase activity; peptidase activity; |
◆ Recombinant Proteins | ||
ATG4A-948H | Recombinant Human ATG4A protein, GST-tagged | +Inquiry |
ATG4A-3034Z | Recombinant Zebrafish ATG4A | +Inquiry |
ATG4A-36H | Recombinant Human ATG4A, His-tagged | +Inquiry |
ATG4A-6522H | Recombinant Human ATG4A protein, His-tagged | +Inquiry |
ATG4A-270R | Recombinant Rhesus Macaque ATG4A Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ATG4A Products
Required fields are marked with *
My Review for All ATG4A Products
Required fields are marked with *
0
Inquiry Basket