Recombinant Human ATG4A, His-tagged

• Cat.No.: ATG4A-36H
• Product Overview: Recombinant Human Cysteine Protease ATG4A/ATG4A is produced with our E. coli expression system. The target protein is expressed with sequence (Met1-Val398) of Human ATG4A fused with a 6His tag at the N-terminus.

Specification

• Description: Cysteine Protease ATG4A (ATG4A) is a cytoplasmic protein that belongs to the peptidase C54 family. ATG4A is widely expressed in many tissues at a low level, but the highest expression is observed in skeletal muscle and brain. ATG4A is a cysteine protease required for autophagy; it cleaves the C-terminal part of MAP1LC3, GABARAPL2 or GABARAP. ATG4A is inhibited by N-ethylmaleimide. It is suggested that ATG4A has a significant role in suppressing various cancers.
• Source: E. coli
• Species: Human
• Tag: His
• Form: Supplied as a 0.2 μM filtered solution of PBS, pH 7.4
• AA Sequence: MGSSHHHHHHSSGLVPRGSHMESVLSKYEDQITIFTDYLEEYPDTDELVWILGKQHLLKTEKSKL LSDISARLWFTYRRKFSPIGGTGPSSDAGWGCMLRCGQMMLAQALICRHLGRDWSWEKQKEQPKE YQRILQCFLDRKDCCYSIHQMAQMGVGEGKSIGEWFGPNTVAQVLKKLALFDEWNSLAVYVSMDN TVVIEDIKKMCRVLPLSADTAGDRPPDSLTASNQSKGTSAYCSAWKPLLLIVPLRLGINQINPVY VDAFKECFKMPQSLGALGGKPNNAYYFIGFLGDELIFLDPHTTQTFVDTEENGTVNDQTFHCLQS PQRMNILNLDPSVALGFFCKEEKDFDNWCSLVQKEILKENLRMFELVQKHPSHWPPFVPPAKPEV TTTGAEFIDSTEQLEEFDLEEDFEILSV
• Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
• Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
• Storage: Store at Please minimize freeze-thaw cycles.
• Protein length: 1-398 a.a.

Gene Information

• Gene Name: ATG4A ATG4 autophagy related 4 homolog A (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: ATG4A
• Synonyms: ATG4A; ATG4 autophagy related 4 homolog A (S. cerevisiae); APG4 autophagy 4 homolog A (S. cerevisiae) , APG4A, AUT like 2, cysteine endopeptidase (S. cerevisiae) , AUTL2; cysteine protease ATG4A; hAPG4A; autophagin 2; autophagin-2; APG4 autophagy 4 homolog A; AUT-like 2 cysteine endopeptidase; AUT-like 2, cysteine endopeptidase; autophagy-related protein 4 homolog A; autophagy-related cysteine endopeptidase 2; APG4A; AUTL2
• Gene ID: 115201
• mRNA Refseq: NM_052936
• Protein Refseq: NP_443168
• MIM: 300663
• UniProt ID: Q8WYN0
• Chromosome Location: Xq22.1-q22.3
• Pathway: Regulation of autophagy, organism-specific biosystem; Regulation of autophagy, conserved biosystem
• Function: cysteine-type peptidase activity; peptidase activity