Recombinant Human ATG16L1 protein, GST-tagged

• Cat.No.: ATG16L1-945H
• Product Overview: Human ATG16L1 full-length ORF ( NP_110430.4, 1 a.a. - 523 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene is part of a large protein complex that is necessary for autophagy, the major process by which intracellular components are targeted to lysosomes for degradation. Defects in this gene are a cause of susceptibility to inflammatory bowel disease type 10 (IBD10). Several transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Jun 2010]
• Molecular Mass: 84.7 kDa
• AA Sequence: MAQLRIKHQEELTELHKKRGELAQLVIDLNNQMQRKDREMQMNEAKIAECLQTISDLETECLDLRTKLCDLERANQTLKDEYDALQITFTALEGKLRKTTEENQELVTRWMAEKAQEANRLNAENEKDSRRRQARLQKELAEAAKEPLPVEQDDDIEVIVDETSDHTEETSPVRAISRAATKRLSQPAGGLLDSITNIFGRRSVSSFPVPQDNVDTHPGSGKEVRVPATALCVFDAHDGEVNAVQFSPGSRLLATGGMDRRVKLWEVFGEKCEFKGSLSGSNAGITSIEFDSAGSYLLAASNDFASRIWTVDDYRLRHTLTGHSGKVLSAKFLLDNARIVSGSHDRTLKLWDLRSKVCIKTVFAGSSCNDIVCTEQCVMSGHFDKKIRFWDIRSESIVREMELLGKITALDLNPERTELLSCSRDDLLKVIDLRTNAIKQTFSAPGFKCGSDWTRVVFSPDGSYVAAGSAEGSLYIWSVLTGKVEKVLSKQHSSSINAVAWSPSGSHVVSVDKGCKAVLWAQY
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Publications:
  The autophagy protein ATG16L1 cooperates with IFT20 and INPP5E to regulate the turnover of phosphoinositides at the primary cilium (2021)

Gene Information

• Gene Name: ATG16L1 ATG16 autophagy related 16-like 1 (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: ATG16L1
• Synonyms: ATG16L1; ATG16 autophagy related 16-like 1 (S. cerevisiae); APG16 autophagy 16 like (S. cerevisiae) , APG16L, ATG16 autophagy related 16 like (S. cerevisiae) , ATG16L; autophagy-related protein 16-1; ATG16A; FLJ10035; WDR30; APG16L beta; WD repeat domain 30; IBD10; APG16L; ATG16L; FLJ00045; FLJ10828; FLJ22677
• Gene ID: 55054
• mRNA Refseq: NM_001190266
• Protein Refseq: NP_001177195
• MIM: 610767
• UniProt ID: Q676U5