Recombinant Human ATG16L1 protein, His-SUMO-tagged
Cat.No. : | ATG16L1-4540H |
Product Overview : | Recombinant Human ATG16L1 protein(Q676U5)(1-607aa), fused to N-terminal His-SUMO tag, was expressed in E. coli |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-607aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 84.3 kDa |
AA Sequence : | MSSGLRAADFPRWKRHISEQLRRRDRLQRQAFEEIILQYNKLLEKSDLHSVLAQKLQAEKHDVPNRHEISPGHDGTWNDNQLQEMAQLRIKHQEELTELHKKRGELAQLVIDLNNQMQRKDREMQMNEAKIAECLQTISDLETECLDLRTKLCDLERANQTLKDEYDALQITFTALEGKLRKTTEENQELVTRWMAEKAQEANRLNAENEKDSRRRQARLQKELAEAAKEPLPVEQDDDIEVIVDETSDHTEETSPVRAISRAATKRLSQPAGGLLDSITNIFGRRSVSSFPVPQDNVDTHPGSGKEVRVPATALCVFDAHDGEVNAVQFSPGSRLLATGGMDRRVKLWEVFGEKCEFKGSLSGSNAGITSIEFDSAGSYLLAASNDFASRIWTVDDYRLRHTLTGHSGKVLSAKFLLDNARIVSGSHDRTLKLWDLRSKVCIKTVFAGSSCNDIVCTEQCVMSGHFDKKIRFWDIRSESIVREMELLGKITALDLNPERTELLSCSRDDLLKVIDLRTNAIKQTFSAPGFKCGSDWTRVVFSPDGSYVAAGSAEGSLYIWSVLTGKVEKVLSKQHSSSINAVAWSPSGSHVVSVDKGCKAVLWAQY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | ATG16L1 ATG16 autophagy related 16-like 1 (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | ATG16L1 |
Synonyms | ATG16L1; ATG16 autophagy related 16-like 1 (S. cerevisiae); APG16 autophagy 16 like (S. cerevisiae) , APG16L, ATG16 autophagy related 16 like (S. cerevisiae) , ATG16L; autophagy-related protein 16-1; ATG16A; FLJ10035; WDR30; APG16L beta; WD repeat domain 30; IBD10; APG16L; ATG16L; FLJ00045; FLJ10828; FLJ22677; |
Gene ID | 55054 |
mRNA Refseq | NM_001190266 |
Protein Refseq | NP_001177195 |
MIM | 610767 |
UniProt ID | Q676U5 |
◆ Recombinant Proteins | ||
ATG16L1-1215HF | Recombinant Full Length Human ATG16L1 Protein, GST-tagged | +Inquiry |
ATG16L1-439R | Recombinant Rhesus monkey ATG16L1 Protein, His-tagged | +Inquiry |
ATG16L1-1470H | Recombinant Human ATG16L1 protein, His & T7-tagged | +Inquiry |
ATG16L1-2577Z | Recombinant Zebrafish ATG16L1 | +Inquiry |
ATG16L1-268R | Recombinant Rhesus Macaque ATG16L1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ATG16L1-146HCL | Recombinant Human ATG16L1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ATG16L1 Products
Required fields are marked with *
My Review for All ATG16L1 Products
Required fields are marked with *
0
Inquiry Basket