Recombinant Human ATG12 protein, GST-tagged

• Cat.No.: ATG12-943H
• Product Overview: Human ATG12 full-length ORF ( AAH11033, 1 a.a. - 74 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: Autophagy is a process of bulk protein degradation in which cytoplasmic components, including organelles, are enclosed in double-membrane structures called autophagosomes and delivered to lysosomes or vacuoles for degradation. ATG12 is the human homolog of a yeast protein involved in autophagy (Mizushima et al., 1998 [PubMed 9852036]).[supplied by OMIM, Mar 2008]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 33.88 kDa
• AA Sequence: MAEEPQSVLQLPTSIAAGGEGLTDVSPETTTPEPPSSAAVSPGTEEPAGDTKKKIYLCESVLCSFPRPRSWNSL
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ATG12 ATG12 autophagy related 12 homolog (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: ATG12
• Synonyms: ATG12; ATG12 autophagy related 12 homolog (S. cerevisiae); Apg12 (autophagy 12, S. cerevisiae) like , APG12 autophagy 12 like (S. cerevisiae) , APG12L; ubiquitin-like protein ATG12; APG12; APG12 autophagy 12 like; autophagy-related protein 12; Apg12 (autophagy, yeast) homolog; FBR93; APG12L; HAPG12
• Gene ID: 9140
• mRNA Refseq: NM_004707
• Protein Refseq: NP_004698
• MIM: 609608
• UniProt ID: O94817