Recombinant Human ATG12 protein, GST-tagged

Cat.No. : ATG12-943H
Product Overview : Human ATG12 full-length ORF ( AAH11033, 1 a.a. - 74 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Autophagy is a process of bulk protein degradation in which cytoplasmic components, including organelles, are enclosed in double-membrane structures called autophagosomes and delivered to lysosomes or vacuoles for degradation. ATG12 is the human homolog of a yeast protein involved in autophagy (Mizushima et al., 1998 [PubMed 9852036]).[supplied by OMIM, Mar 2008]
Molecular Mass : 33.88 kDa
AA Sequence : MAEEPQSVLQLPTSIAAGGEGLTDVSPETTTPEPPSSAAVSPGTEEPAGDTKKKIYLCESVLCSFPRPRSWNSL
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ATG12 ATG12 autophagy related 12 homolog (S. cerevisiae) [ Homo sapiens ]
Official Symbol ATG12
Synonyms ATG12; ATG12 autophagy related 12 homolog (S. cerevisiae); Apg12 (autophagy 12, S. cerevisiae) like , APG12 autophagy 12 like (S. cerevisiae) , APG12L; ubiquitin-like protein ATG12; APG12; APG12 autophagy 12 like; autophagy-related protein 12; Apg12 (autophagy, yeast) homolog; FBR93; APG12L; HAPG12;
Gene ID 9140
mRNA Refseq NM_004707
Protein Refseq NP_004698
MIM 609608
UniProt ID O94817

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ATG12 Products

Required fields are marked with *

My Review for All ATG12 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon