Recombinant Human ATF6, His-tagged

Cat.No. : ATF6-26190TH
Product Overview : Recombinant fragment, corresponding to amino acids 567-670 of Human ATF6 with N terminal His tag, 104aa, 25kDa,
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 567-670 a.a.
Description : This gene encodes a transcription factor that activates target genes for the unfolded protein response (UPR) during endoplasmic reticulum (ER) stress. Although it is a transcription factor, this protein is unusual in that it is synthesized as a transmembrane protein that is embedded in the ER. It functions as an ER stress sensor/transducer, and following ER stress-induced proteolysis, it functions as a nuclear transcription factor via a cis-acting ER stress response element (ERSE) that is present in the promoters of genes encoding ER chaperones. This protein has been identified as a survival factor for quiescent but not proliferative squamous carcinoma cells. There have been conflicting reports about the association of polymorphisms in this gene with diabetes in different populations, but another polymorphism has been associated with increased plasma cholesterol levels. This gene is also thought to be a potential therapeutic target for cystic fibrosis.
Conjugation : HIS
Tissue specificity : Ubiquitous.
Form : Lyophilised:reconstitution with 92 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Store at 4°C. Upon reconstitution store at -80oC.
Sequences of amino acids : YVVSFRRDHLLLPATTHNKTTRPKMSIVLPAININENVIN GQDYEVMMQIDCQVMDTRILHIKSSSVPPYLRDQQRNQ TNTFFGSPPAATEATHVVSTIPESLQ
Sequence Similarities : Belongs to the bZIP family. ATF subfamily.Contains 1 bZIP domain.
Gene Name ATF6 activating transcription factor 6 [ Homo sapiens ]
Official Symbol ATF6
Synonyms ATF6; activating transcription factor 6; cyclic AMP-dependent transcription factor ATF-6 alpha; activating transcription factor 6 alpha; ATF6A;
Gene ID 22926
mRNA Refseq NM_007348
Protein Refseq NP_031374
MIM 605537
Uniprot ID P18850
Chromosome Location 1q22-q23
Pathway Activation of Chaperones by ATF6-alpha, organism-specific biosystem; Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Diabetes pathways, organism-specific biosystem; Protein processing in endoplasmic reticulum, organism-specific biosystem;
Function protein binding; protein dimerization activity; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; transcription coactivator activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ATF6 Products

Required fields are marked with *

My Review for All ATF6 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon