Recombinant Human ATF6, His-tagged
Cat.No. : | ATF6-26190TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 567-670 of Human ATF6 with N terminal His tag, 104aa, 25kDa, |
- Specification
- Gene Information
- Related Products
- Download
Description : | This gene encodes a transcription factor that activates target genes for the unfolded protein response (UPR) during endoplasmic reticulum (ER) stress. Although it is a transcription factor, this protein is unusual in that it is synthesized as a transmembrane protein that is embedded in the ER. It functions as an ER stress sensor/transducer, and following ER stress-induced proteolysis, it functions as a nuclear transcription factor via a cis-acting ER stress response element (ERSE) that is present in the promoters of genes encoding ER chaperones. This protein has been identified as a survival factor for quiescent but not proliferative squamous carcinoma cells. There have been conflicting reports about the association of polymorphisms in this gene with diabetes in different populations, but another polymorphism has been associated with increased plasma cholesterol levels. This gene is also thought to be a potential therapeutic target for cystic fibrosis. |
Conjugation : | HIS |
Source : | E. coli |
Tissue specificity : | Ubiquitous. |
Form : | Lyophilised:reconstitution with 92 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Store at 4°C. Upon reconstitution store at -80oC. |
Sequences of amino acids : | YVVSFRRDHLLLPATTHNKTTRPKMSIVLPAININENVIN GQDYEVMMQIDCQVMDTRILHIKSSSVPPYLRDQQRNQ TNTFFGSPPAATEATHVVSTIPESLQ |
Sequence Similarities : | Belongs to the bZIP family. ATF subfamily.Contains 1 bZIP domain. |
Protein length : | 567-670 a.a. |
Gene Name | ATF6 activating transcription factor 6 [ Homo sapiens ] |
Official Symbol | ATF6 |
Synonyms | ATF6; activating transcription factor 6; cyclic AMP-dependent transcription factor ATF-6 alpha; activating transcription factor 6 alpha; ATF6A; |
Gene ID | 22926 |
mRNA Refseq | NM_007348 |
Protein Refseq | NP_031374 |
MIM | 605537 |
Uniprot ID | P18850 |
Chromosome Location | 1q22-q23 |
Pathway | Activation of Chaperones by ATF6-alpha, organism-specific biosystem; Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Diabetes pathways, organism-specific biosystem; Protein processing in endoplasmic reticulum, organism-specific biosystem; |
Function | protein binding; protein dimerization activity; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; transcription coactivator activity; |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ATF6 Products
Required fields are marked with *
My Review for All ATF6 Products
Required fields are marked with *
0
Inquiry Basket