Recombinant Human ATF4 protein, GST-tagged
Cat.No. : | ATF4-939H |
Product Overview : | Human ATF4 full-length ORF ( AAH08090, 1 a.a. - 351 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a transcription factor that was originally identified as a widely expressed mammalian DNA binding protein that could bind a tax-responsive enhancer element in the LTR of HTLV-1. The encoded protein was also isolated and characterized as the cAMP-response element binding protein 2 (CREB-2). The protein encoded by this gene belongs to a family of DNA-binding proteins that includes the AP-1 family of transcription factors, cAMP-response element binding proteins (CREBs) and CREB-like proteins. These transcription factors share a leucine zipper region that is involved in protein-protein interactions, located C-terminal to a stretch of basic amino acids that functions as a DNA binding domain. Two alternative transcripts encoding the same protein have been described. Two pseudogenes are located on the X chromosome at q28 in a region containing a large inverted duplication. [provided by RefSeq, Sep 2011] |
Molecular Mass : | 64.35 kDa |
AA Sequence : | MTEMSFLSSEVLVGDLMSPFDPSGLGAEESLGLLDDYLEVAKHFKPHGFSSDKAKAGSSEWLAVDGLVSPSNNSKEDAFSGTDWMLEKMDLKEFDLDALLGIDDLETMPDDLLTTLDDTCDLFAPLVQETNKQPPQTVNPIGHLPESLTKPDQVAPFTFLQPPPLSPGVLSSTPDHSFSLELGSEVDITEGDRKPDYTAYVAMIPQCIKEEDTPSDNDSGICMSPESYLGSPQHSPSTRGSPNRSLPSPGVLCGSARPKPYDPPGEKMVAAKVKGEKLDKKLKKMEQNKTAATRYRQKKRAEQEALTGECKELEKKNEALKERADSLAKEIQYLKDLIEEVRKARGKKRVP |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ATF4 activating transcription factor 4 (tax-responsive enhancer element B67) [ Homo sapiens ] |
Official Symbol | ATF4 |
Synonyms | ATF4; activating transcription factor 4 (tax-responsive enhancer element B67); TXREB; cyclic AMP-dependent transcription factor ATF-4; CREB 2; TAXREB67; DNA-binding protein TAXREB67; cAMP response element-binding protein 2; cAMP-dependent transcription factor ATF-4; cAMP-responsive element-binding protein 2; cyclic AMP-responsive element-binding protein 2; tax-responsive enhancer element-binding protein 67; CREB2; CREB-2; |
Gene ID | 468 |
mRNA Refseq | NM_001675 |
Protein Refseq | NP_001666 |
MIM | 604064 |
UniProt ID | P18848 |
◆ Recombinant Proteins | ||
ATF4-7942H | Recombinant Human ATF4 protein, GST-tagged | +Inquiry |
ATF4-27047TH | Recombinant Human ATF4, His-tagged | +Inquiry |
ATF4-27048TH | Recombinant Human ATF4, His-tagged | +Inquiry |
ATF4-939H | Recombinant Human ATF4 protein, GST-tagged | +Inquiry |
ATF4-6443C | Recombinant Chicken ATF4 | +Inquiry |
◆ Cell & Tissue Lysates | ||
ATF4-8630HCL | Recombinant Human ATF4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ATF4 Products
Required fields are marked with *
My Review for All ATF4 Products
Required fields are marked with *
0
Inquiry Basket