Recombinant Human ASPA protein, GST-tagged
Cat.No. : | ASPA-916H |
Product Overview : | Human ASPA full-length ORF ( NP_000040.1, 1 a.a. - 313 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes an enzyme that catalyzes the conversion of N-acetyl_L-aspartic acid (NAA) to aspartate and acetate. NAA is abundant in the brain where hydrolysis by aspartoacylase is thought to help maintain white matter. This protein is an NAA scavenger in other tissues. Mutations in this gene cause Canavan disease. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 62.1 kDa |
AA Sequence : | MTSCHIAEEHIQKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKKCTRYIDCDLNRIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTSNMGCTLILEDSRNNFLIQMFHYIKTSLAPLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADILDQMRKMIKHALDFIHHFNEGKEFPPCAIEVYKIIEKVDYPRDENGEIAAIIHPNLQDQDWKPLHPGDPMFLTLDGKTIPLGGDCTVYPVFVNEAAYYEKKEAFAKTTKLTLNAKSIRCCLH |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ASPA aspartoacylase [ Homo sapiens ] |
Official Symbol | ASPA |
Synonyms | ASPA; aspartoacylase; aspartoacylase (aminoacylase 2, Canavan disease); ACY2; aminoacylase 2; ASP; Canavan disease; ACY-2; aminoacylase-2; |
Gene ID | 443 |
mRNA Refseq | NM_000049 |
Protein Refseq | NP_000040 |
MIM | 608034 |
UniProt ID | P45381 |
◆ Recombinant Proteins | ||
ASPA-163H | Recombinant Human ASPA protein, MYC/DDK-tagged | +Inquiry |
ASPA-2560H | Recombinant Human ASPA protein, His&Myc-tagged | +Inquiry |
ASPA-162H | Recombinant Human ASPA protein, MYC/DDK-tagged | +Inquiry |
ASPA-916H | Recombinant Human ASPA protein, GST-tagged | +Inquiry |
ASPA-67C | Recombinant Cynomolgus Monkey ASPA Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ASPA-8647HCL | Recombinant Human ASPA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ASPA Products
Required fields are marked with *
My Review for All ASPA Products
Required fields are marked with *
0
Inquiry Basket