Recombinant Human ASH2L protein, GST-tagged

• Cat.No.: ASH2L-906H
• Product Overview: Human ASH2L full-length ORF ( AAH15936.1, 1 a.a. - 534 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: ASH2L (ASH2 Like Histone Lysine Methyltransferase Complex Subunit) is a Protein Coding gene. Diseases associated with ASH2L include Kabuki Syndrome 1. Among its related pathways are Signaling by Wnt and Chromatin organization. GO annotations related to this gene include transcription regulatory region DNA binding and histone methyltransferase activity (H3-K4 specific).
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 86.6 kDa
• AA Sequence: MDTQAGSVDEENGRQLGEVELQCGICTKWFTADTFGIDTSSCLPFMTNYSFHCNVCHHSGNTYFLRKQANLKEMCLSALANLTWQSRTQDEHPKTMFSKDKDIIPFIDKYWECMTTRQRPGKMTWPNNIVKTMSKERDVFLVKEHPDPGSKDPEEDYPKFGLLDQDLSNIGPAYDNQKQSSAVSTSGNLNGGIAAGSSGKGRGAKRKQQDGGTTGTTKKARSDPLFSAQRLPPHGYPLEHPFNKDGYRYILAEPDPHAPDPEKLELDCWAGKPIPGDLYRACLYERVLLALHDRAPQLKISDDRLTVVGEKGYSMVRASHGVRKGAWYFEITVDEMPPDTAARLGWSQPLGNLQAPLGYDKFSYSWRSKKGTKFHQSIGKHYSSGYGQGDVLGFYINLPEDTETAKSLPDTYKDKALIKFKSYLYFEEKDFVDKAEKSLKQTPHSEIIFYKNGVNQGVAYKDIFEGVYFPAISLYKSCTVSINFGPCFKYPPKDLTYRPMSDMGWGAVVEHTLADVLYHVETEVDGRRSPPWEP
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ASH2L ash2 (absent, small, or homeotic)-like (Drosophila) [ Homo sapiens ]
• Official Symbol: ASH2L
• Synonyms: ASH2L; ash2 (absent, small, or homeotic)-like (Drosophila); ash2 (absent, small, or homeotic, Drosophila, homolog) like , ASH2L1; set1/Ash2 histone methyltransferase complex subunit ASH2; ASH2; ASH2L2; Bre2; ASH2-like protein; ASH2L1
• Gene ID: 9070
• mRNA Refseq: NM_001105214
• Protein Refseq: NP_001098684
• MIM: 604782
• UniProt ID: Q9UBL3