Recombinant Human ASF1B protein, GST-tagged
Cat.No. : | ASF1B-904H |
Product Overview : | Human ASF1B full-length ORF ( AAH36521, 1 a.a. - 202 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Description : | This gene encodes a member of the H3/H4 family of histone chaperone proteins and is similar to the anti-silencing function-1 gene in yeast. The encoded protein is the substrate of the tousled-like kinase family of cell cycle-regulated kinases, and may play a key role in modulating the nucleosome structure of chromatin by ensuring a constant supply of histones at sites of nucleosome assembly. [provided by RefSeq, Jul 2008] |
Source : | Wheat Germ |
Species : | Human |
Tag : | GST |
Molecular Mass : | 47.96 kDa |
AA Sequence : | MAKVSVLNVAVLENPSPFHSPFRFEISFECSEALADDLEWKIIYVGSAESEEFGQILDSVLVGPVPAGRHMFVFQADAPNPSLIPETDAVGVTVVLITCTYHGQEFIRVGYYVNNEYLNPELRENPPMKPDFSQLQRNILASNPRVTRFHINWDNNMDRLEAIETQDPSLGCGLPLNCTPIKGLGLPGCIPGLLPENSMDCI |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ASF1B ASF1 anti-silencing function 1 homolog B (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | ASF1B |
Synonyms | ASF1B; ASF1 anti-silencing function 1 homolog B (S. cerevisiae); histone chaperone ASF1B; FLJ10604; hAsf1; hAsf1b; hCIA-II; CCG1-interacting factor A-II; anti-silencing function protein 1 homolog B; CIA-II; |
Gene ID | 55723 |
mRNA Refseq | NM_018154 |
Protein Refseq | NP_060624 |
MIM | 609190 |
UniProt ID | Q9NVP2 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ASF1B Products
Required fields are marked with *
My Review for All ASF1B Products
Required fields are marked with *
0
Inquiry Basket