Recombinant Human ASF1B Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | ASF1B-1336H |
Product Overview : | ASF1B MS Standard C13 and N15-labeled recombinant protein (NP_060624) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a member of the H3/H4 family of histone chaperone proteins and is similar to the anti-silencing function-1 gene in yeast. The encoded protein is the substrate of the tousled-like kinase family of cell cycle-regulated kinases, and may play a key role in modulating the nucleosome structure of chromatin by ensuring a constant supply of histones at sites of nucleosome assembly. |
Molecular Mass : | 22.4 kDa |
AA Sequence : | MAKVSVLNVAVLENPSPFHSPFRFEISFECSEALADDLEWKIIYVGSAESEEFDQILDSVLVGPVPAGRHMFVFQADAPNPSLIPETDAVGVTVVLITCTYHGQEFIRVGYYVNNEYLNPELRENPPMKPDFSQLQRNILASNPRVTRFHINWDNNMDRLEAIETQDPSLGCGLPLNCTPIKGLGLPGCIPGLLPENSMDCITRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | ASF1B anti-silencing function 1B histone chaperone [ Homo sapiens (human) ] |
Official Symbol | ASF1B |
Synonyms | ASF1B; ASF1 anti-silencing function 1 homolog B (S. cerevisiae); histone chaperone ASF1B; FLJ10604; hAsf1; hAsf1b; hCIA-II; CCG1-interacting factor A-II; anti-silencing function protein 1 homolog B; CIA-II; |
Gene ID | 55723 |
mRNA Refseq | NM_018154 |
Protein Refseq | NP_060624 |
MIM | 609190 |
UniProt ID | Q9NVP2 |
◆ Recombinant Proteins | ||
ASF1B-8652H | Recombinant Human ASF1B, His tagged | +Inquiry |
ASF1B-2029M | Recombinant Mouse ASF1B Protein | +Inquiry |
ASF1B-2363H | Recombinant Human ASF1B protein, His-tagged | +Inquiry |
ASF1B-6956H | Recombinant Human ASF1 Anti-Silencing Function 1 Homolog B (S. cerevisiae), His-tagged | +Inquiry |
ASF1B-788M | Recombinant Mouse ASF1B Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ASF1B-001HCL | Recombinant Human ASF1B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ASF1B Products
Required fields are marked with *
My Review for All ASF1B Products
Required fields are marked with *
0
Inquiry Basket