Recombinant Human ARX protein, GST-tagged

• Cat.No.: ARX-876H
• Product Overview: Human ARX partial ORF (NP_620689, 159 a.a. - 264 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene is a homeobox-containing gene expressed during development. The expressed protein contains two conserved domains, a C-peptide (or aristaless domain) and the prd-like class homeobox domain. It is a member of the group-II aristaless-related protein family whose members are expressed primarily in the central and/or peripheral nervous system. This gene is thought to be involved in CNS development. Expansion of a polyalanine tract and other mutations in this gene cause X-linked mental retardation and epilepsy. [provided by RefSeq, Jul 2016]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 37.29 kDa
• AA Sequence: LKISQAPQVSISRSKSYRENGAPFVPPPPALDELGGPGGVTHPEERLGVAGGPGSAPAAGGGTGTEDDEEELLEDEEDEDEEEELLEDDEEELLEDDARALLKEPR
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ARX aristaless related homeobox [ Homo sapiens ]
• Official Symbol: ARX
• Synonyms: ARX; aristaless related homeobox; mental retardation, X linked 29 , mental retardation, X linked 32 , mental retardation, X linked 33 , mental retardation, X linked 36 , mental retardation, X linked 38 , mental retardation, X linked 43 , mental retardation, X linked 54 , mental retardation, X linked 76 , mental retardation, X linked 87 , MRX29, MRX32, MRX33, MRX36, MRX38, MRX43, MRX54, MRX76, MRX87, MRXS1, PRTS; homeobox protein ARX; cancer/testis antigen 121; CT121; EIEE1; ISSX; aristaless-related homeobox, X-linked; PRTS; MRX29; MRX32; MRX33; MRX36; MRX38; MRX43; MRX54; MRX76; MRX87; MRXS1
• Gene ID: 170302
• mRNA Refseq: NM_139058
• Protein Refseq: NP_620689
• MIM: 300382
• UniProt ID: Q96QS3