Recombinant Human ARX protein, GST-tagged
Cat.No. : | ARX-876H |
Product Overview : | Human ARX partial ORF (NP_620689, 159 a.a. - 264 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene is a homeobox-containing gene expressed during development. The expressed protein contains two conserved domains, a C-peptide (or aristaless domain) and the prd-like class homeobox domain. It is a member of the group-II aristaless-related protein family whose members are expressed primarily in the central and/or peripheral nervous system. This gene is thought to be involved in CNS development. Expansion of a polyalanine tract and other mutations in this gene cause X-linked mental retardation and epilepsy. [provided by RefSeq, Jul 2016] |
Molecular Mass : | 37.29 kDa |
AA Sequence : | LKISQAPQVSISRSKSYRENGAPFVPPPPALDELGGPGGVTHPEERLGVAGGPGSAPAAGGGTGTEDDEEELLEDEEDEDEEEELLEDDEEELLEDDARALLKEPR |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ARX aristaless related homeobox [ Homo sapiens ] |
Official Symbol | ARX |
Synonyms | ARX; aristaless related homeobox; mental retardation, X linked 29 , mental retardation, X linked 32 , mental retardation, X linked 33 , mental retardation, X linked 36 , mental retardation, X linked 38 , mental retardation, X linked 43 , mental retardation, X linked 54 , mental retardation, X linked 76 , mental retardation, X linked 87 , MRX29, MRX32, MRX33, MRX36, MRX38, MRX43, MRX54, MRX76, MRX87, MRXS1, PRTS; homeobox protein ARX; cancer/testis antigen 121; CT121; EIEE1; ISSX; aristaless-related homeobox, X-linked; PRTS; MRX29; MRX32; MRX33; MRX36; MRX38; MRX43; MRX54; MRX76; MRX87; MRXS1; |
Gene ID | 170302 |
mRNA Refseq | NM_139058 |
Protein Refseq | NP_620689 |
MIM | 300382 |
UniProt ID | Q96QS3 |
◆ Recombinant Proteins | ||
ARX-812R | Recombinant Rat ARX Protein | +Inquiry |
ARX-4868H | Recombinant Human ARX Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ARX-1996M | Recombinant Mouse ARX Protein | +Inquiry |
ARX-876H | Recombinant Human ARX protein, GST-tagged | +Inquiry |
ARX-547H | Recombinant Human ARX Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ARX Products
Required fields are marked with *
My Review for All ARX Products
Required fields are marked with *
0
Inquiry Basket