Recombinant Human ARSB therapeutic protein(Galsulfase)
Cat.No. : | ARSB-P038H |
Product Overview : | Recombinant Human N-acetylgalactosamine 4-sulfatase is a variant form of the polymorphic human enzyme N-acetylgalactosamine 4-sulfatase of recombinant?DNA origin. It is a glycoprotein with a molecular weight of approximately 56 kD. The recombinant protein is comprised of 495 amino acids and contains six asparagine-linked glycosylation sites, four of which carry a bis mannose-6-phosphate manose7 oligosaccharide for specific cellular recognition. Post-translational modification of Cys53 produces the catalytic amino acid residue Ca-formylglycine, which is required for enzyme activity and is conserved in all members of the sulfatase enzyme family. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Tag : | Non |
Protein Length : | 495 aa |
Description : | It is a lysosomal hydrolase that catalyzes the cleavage of the sulfate ester from terminal N-acetylgalactosamine 4-sulfate residues of GAG chondroitin 4-sulfate and dermatan sulfate. Increased catabolism of GAG in turn reduces systemic dermatan sulfate accumulation, thereby reducing the primary symptoms of MPS VI. |
Molecular Mass : | 56 kDa |
AA Sequence : | SGAGASRPPHLVFLLADDLGWNDVGFHGSRIRTPHLDALAAGGVLLDNYYTQPLCTPSRSQLLTGRYQIRT GLQHQIIWPCQPSCVPLDEKLLPQLLKEAGYTTHMVGKWHLGMYRKECLPTRRGFDTYFGYLLGSEDYYSH ERCTLIDALNVTRCALDFRDGEEVATGYKNMYSTNIFTKRAIALITNHPPEKPLFLYLALQSVHEPLQVPE EYLKPYDFIQDKNRHHYAGMVSLMDEAVGNVTAALKSSGLWNNTVFIFSTDNGGQTLAGGNNWPLRGRKWS LWEGGVRGVGFVASPLLKQKGVKNRELIHISDWLPTLVKLARGHTNGTKPLDGFDVWKTISEGSPSPRIEL LHNIDPNFVDSSPCPRNSMAPAKDDSSLPEYSAFNTSVHAAIRHGNWKLLTGYPGCGYWFPPPSQYN VSEIPSSDPPTKTLWLFDIDRDPEERHDLSREYPHIVTKLLSRLQFYHKHSVPVYFPAQDPRCDPKATGVW GPWM |
Endotoxin : | < 0.1 EU per μg of the protein |
Purity : | >95% |
Alias : | ASB; G4S; MPS6; Galsulfase |
Gene Name | ARSB arylsulfatase B [ Homo sapiens ] |
Official Symbol | ARSB |
Synonyms | ASB; G4S; MPS6; arylsulfatase B |
Gene ID | 411 |
mRNA Refseq | NM_000046 |
Protein Refseq | NP_000037 |
MIM | 611542 |
UniProt ID | P15848 |
Chromosome Location | 5q14.1 |
Pathway | CS/DS degradation, organism-specific biosystem; Chondroitin sulfate degradation, conserved biosystem; Glycosaminoglycan degradation, organism-specific biosystem |
Function | N-acetylgalactosamine-4-sulfatase activity; N-acetylgalactosamine-4-sulfatase activity; arylsulfatase activity |
◆ Recombinant Proteins | ||
ARSB-3370H | Recombinant Human ARSB Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ARSB-26104TH | Recombinant Human ARSB | +Inquiry |
ARSB-1062H | Active Recombinant Human ARSB, His-tagged | +Inquiry |
ARSB-383H | Recombinant Human ARSB Protein, His (Fc)-Avi-tagged | +Inquiry |
Arsb-3659R | Recombinant Rat Arsb, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARSB-8677HCL | Recombinant Human ARSB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ARSB Products
Required fields are marked with *
My Review for All ARSB Products
Required fields are marked with *
0
Inquiry Basket