Recombinant Human ARSB therapeutic protein(Galsulfase)

• Cat.No.: ARSB-P038H
• Product Overview: Recombinant Human N-acetylgalactosamine 4-sulfatase is a variant form of the polymorphic human enzyme N-acetylgalactosamine 4-sulfatase of recombinant?DNA origin. It is a glycoprotein with a molecular weight of approximately 56 kD. The recombinant protein is comprised of 495 amino acids and contains six asparagine-linked glycosylation sites, four of which carry a bis mannose-6-phosphate manose7 oligosaccharide for specific cellular recognition. Post-translational modification of Cys53 produces the catalytic amino acid residue Ca-formylglycine, which is required for enzyme activity and is conserved in all members of the sulfatase enzyme family.

Specification

• Species: Human
• Tag: Non
• Protein Length: 495 aa
• Description: It is a lysosomal hydrolase that catalyzes the cleavage of the sulfate ester from terminal N-acetylgalactosamine 4-sulfate residues of GAG chondroitin 4-sulfate and dermatan sulfate. Increased catabolism of GAG in turn reduces systemic dermatan sulfate accumulation, thereby reducing the primary symptoms of MPS VI.
• Molecular Mass: 56 kDa
• AA Sequence: SGAGASRPPHLVFLLADDLGWNDVGFHGSRIRTPHLDALAAGGVLLDNYYTQPLCTPSRSQLLTGRYQIRT GLQHQIIWPCQPSCVPLDEKLLPQLLKEAGYTTHMVGKWHLGMYRKECLPTRRGFDTYFGYLLGSEDYYSH ERCTLIDALNVTRCALDFRDGEEVATGYKNMYSTNIFTKRAIALITNHPPEKPLFLYLALQSVHEPLQVPE EYLKPYDFIQDKNRHHYAGMVSLMDEAVGNVTAALKSSGLWNNTVFIFSTDNGGQTLAGGNNWPLRGRKWS LWEGGVRGVGFVASPLLKQKGVKNRELIHISDWLPTLVKLARGHTNGTKPLDGFDVWKTISEGSPSPRIEL LHNIDPNFVDSSPCPRNSMAPAKDDSSLPEYSAFNTSVHAAIRHGNWKLLTGYPGCGYWFPPPSQYN VSEIPSSDPPTKTLWLFDIDRDPEERHDLSREYPHIVTKLLSRLQFYHKHSVPVYFPAQDPRCDPKATGVW GPWM
• Endotoxin: < 0.1 EU per μg of the protein
• Purity: >95%
• Alias: ASB; G4S; MPS6; Galsulfase

Gene Information

• Gene Name: ARSB arylsulfatase B [ Homo sapiens ]
• Official Symbol: ARSB
• Synonyms: ASB; G4S; MPS6; arylsulfatase B
• Gene ID: 411
• mRNA Refseq: NM_000046
• Protein Refseq: NP_000037
• MIM: 611542
• UniProt ID: P15848
• Chromosome Location: 5q14.1
• Pathway: CS/DS degradation, organism-specific biosystem; Chondroitin sulfate degradation, conserved biosystem; Glycosaminoglycan degradation, organism-specific biosystem
• Function: N-acetylgalactosamine-4-sulfatase activity; N-acetylgalactosamine-4-sulfatase activity; arylsulfatase activity