Recombinant Human ARSB

Description :	Arylsulfatase B encoded by this gene belongs to the sulfatase family. The arylsulfatase B homodimer hydrolyzes sulfate groups of N-Acetyl-D-galactosamine, chondriotin sulfate, and dermatan sulfate. The protein is targetted to the lysozyme. Mucopolysaccharidosis type VI is an autosomal recessive lysosomal storage disorder resulting from a deficiency of arylsulfatase B. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Protein length :	100 amino acids
Molecular Weight :	36.630kDa inclusive of tags
Source :	Wheat germ
Form :	Liquid
Purity :	Proprietary Purification
Storage buffer :	pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage :	Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids :	FGYLLGSEDYYSHERCTLIDALNVTRCALDFRDGEEVATGYKNMYSTNIFTKRAIALITNHPPEKPLFLYLALQSVHEPLQVPEEYLKPYDFIQDKNRHH
Sequence Similarities :	Belongs to the sulfatase family.
Tag :	Non

Gene Name	ARSB arylsulfatase B [ Homo sapiens ]
Official Symbol	ARSB
Synonyms	ARSB; arylsulfatase B;
Gene ID	411
mRNA Refseq	NM_000046
Protein Refseq	NP_000037
MIM	611542
Uniprot ID	P15848
Chromosome Location	5p11-q13
Pathway	Chondroitin sulfate degradation, organism-specific biosystem; Chondroitin sulfate degradation, conserved biosystem; Dermatan sulfate degradation, organism-specific biosystem; Dermatan sulfate degradation, conserved biosystem; Glycosaminoglycan degradation, organism-specific biosystem;
Function	N-acetylgalactosamine-4-sulfatase activity; arylsulfatase activity; catalytic activity; hydrolase activity; metal ion binding;