Recombinant Human ARRDC1-AS1 Protein, GST-Tagged

• Cat.No.: ARRDC1-AS1-0198H
• Product Overview: Human ARRDC1-AS1 full-length ORF (NP_116326.2, 1 a.a. - 176 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This transcribed locus is thought to be non-coding. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2014]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 44.4 kDa
• AA Sequence: MEFHYVAQADLELLTSSNPPASASQSTGITGGSHRARPGPVHFIDKVTDKPSHSHPFALKENWNLNPEPSSPPSPLFLEAPSRQASQHHGASPGAGTSAGCPFEKCCSTEPCLSGLGDVGRGEAASLRARPGSGASRGQGPGSRVSCRRDLGKPLHAPAGFSAGEVHTTPLGNLGA
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Protein length: 1-176 a.a.

Gene Information

• Gene Name: ARRDC1-AS1 ARRDC1 antisense RNA 1 [ Homo sapiens (human) ]
• Official Symbol: ARRDC1-AS1
• Synonyms: ARRDC1-AS1; ARRDC1 antisense RNA 1; C9orf37; ARRDC1 Antisense RNA 1; Chromosome 9 Open Reading Frame 37; ARRDC1 Antisense Gene Protein 1; AD038
• Gene ID: 85026
• mRNA Refseq: NM_032937
• Protein Refseq: NP_116326
• UniProt ID: Q9H2J1