Recombinant Full Length Human ARRDC1-AS1 Protein, GST-tagged

Cat.No. : ARRDC1-AS1-2697HF
Product Overview : Human ARRDC1-AS1 full-length ORF (NP_116326.2, 1 a.a. - 176 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : This transcribed locus is thought to be non-coding. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2014]
Source : In Vitro Cell Free System
Species : Human
Tag : GST
Molecular Mass : 44.4 kDa
Protein length : 176 amino acids
AA Sequence : MEFHYVAQADLELLTSSNPPASASQSTGITGGSHRARPGPVHFIDKVTDKPSHSHPFALKENWNLNPEPSSPPSPLFLEAPSRQASQHHGASPGAGTSAGCPFEKCCSTEPCLSGLGDVGRGEAASLRARPGSGASRGQGPGSRVSCRRDLGKPLHAPAGFSAGEVHTTPLGNLGA
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ARRDC1-AS1 ARRDC1 antisense RNA 1 [ Homo sapiens (human) ]
Official Symbol ARRDC1-AS1
Synonyms ARRDC1-AS1; ARRDC1 antisense RNA 1; C9orf37; ARRDC1 Antisense RNA 1; Chromosome 9 Open Reading Frame 37; ARRDC1 Antisense Gene Protein 1; AD038
Gene ID 85026
mRNA Refseq NM_032937
Protein Refseq NP_116326
UniProt ID Q9H2J1

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ARRDC1-AS1 Products

Required fields are marked with *

My Review for All ARRDC1-AS1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon