Recombinant Human ARRB1
Cat.No. : | ARRB1-26620TH |
Product Overview : | Recombinant fragment corresponding to amino acids 13-122 of Human beta Arrestin 1 with an N terminal proprietary tag; Predicted MWt 37.73 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 110 amino acids |
Description : | Members of arrestin/beta-arrestin protein family are thought to participate in agonist-mediated desensitization of G-protein-coupled receptors and cause specific dampening of cellular responses to stimuli such as hormones, neurotransmitters, or sensory signals. Arrestin beta 1 is a cytosolic protein and acts as a cofactor in the beta-adrenergic receptor kinase (BARK) mediated desensitization of beta-adrenergic receptors. Besides the central nervous system, it is expressed at high levels in peripheral blood leukocytes, and thus the BARK/beta-arrestin system is believed to play a major role in regulating receptor-mediated immune functions. Alternatively spliced transcripts encoding different isoforms of arrestin beta 1 have been described. |
Molecular Weight : | 37.730kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | SPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERR VYVTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPE DKKPLTRLQERLIKKLGEHAYPFTFEIPPN |
Sequence Similarities : | Belongs to the arrestin family. |
Gene Name | ARRB1 arrestin, beta 1 [ Homo sapiens ] |
Official Symbol | ARRB1 |
Synonyms | ARRB1; arrestin, beta 1; ARR1; beta-arrestin-1; arrestin 2; |
Gene ID | 408 |
mRNA Refseq | NM_004041 |
Protein Refseq | NP_004032 |
MIM | 107940 |
Uniprot ID | P49407 |
Chromosome Location | 11q13 |
Pathway | CXCR3-mediated signaling events, organism-specific biosystem; Calcium Regulation in the Cardiac Cell, organism-specific biosystem; Chemokine signaling pathway, organism-specific biosystem; Chemokine signaling pathway, conserved biosystem; Clathrin derived vesicle budding, organism-specific biosystem; |
Function | GTPase activator activity; angiotensin receptor binding; enzyme inhibitor activity; NOT histone acetyltransferase activity; insulin-like growth factor receptor binding; |
◆ Recombinant Proteins | ||
ARRB1-0239H | Recombinant Human ARRB1 Protein (Asp3-Thr246), N-His-tagged | +Inquiry |
ARRB1-1857M | Recombinant Mouse Arrb1 protein, His-tagged | +Inquiry |
ARRB1-458R | Recombinant Rat ARRB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ARRB1-26622TH | Recombinant Human ARRB1 | +Inquiry |
ARRB1-802R | Recombinant Rat ARRB1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARRB1-8679HCL | Recombinant Human ARRB1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ARRB1 Products
Required fields are marked with *
My Review for All ARRB1 Products
Required fields are marked with *
0
Inquiry Basket