Recombinant Human ARL8A Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : ARL8A-1948H
Product Overview : ARL8A MS Standard C13 and N15-labeled recombinant protein (NP_620150) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Plays a role in lysosome motility. In neurons, mediates the anterograde axonal long-range transport of presynaptic lysosome-related vesicles required for presynaptic biogenesis and synaptic function. May play a role in chromosome segregation.
Molecular Mass : 21.4 kDa
AA Sequence : MIALFNKLLDWFKALFWKEEMELTLVGLQYSGKTTFVNVIASGQFNEDMIPTVGFNMRKITKGNVTIKLWDIGGQPRFRSMWERYCRGVSAIVYMVDAADQEKIEASKNELHNLLDKPQLQGIPVLVLGNKRDLPGALDEKELIEKMNLSAIQDREICCYSISCKEKDNIDITLQWLIQHSKSRRSTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name ARL8A ADP-ribosylation factor-like 8A [ Homo sapiens (human) ]
Official Symbol ARL8A
Synonyms ARL8A; ADP-ribosylation factor-like 8A; ADP ribosylation factor like 10B, ARL10B; ADP-ribosylation factor-like protein 8A; FLJ45195; Gie2; ADP-ribosylation factor-like 10B; novel small G protein indispensable for equal chromosome segregation 2; GIE2; ARL10B;
Gene ID 127829
mRNA Refseq NM_138795
Protein Refseq NP_620150
MIM 616597
UniProt ID Q96BM9

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ARL8A Products

Required fields are marked with *

My Review for All ARL8A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon