Recombinant Human ARL8A Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: ARL8A-1948H
• Product Overview: ARL8A MS Standard C13 and N15-labeled recombinant protein (NP_620150) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: Plays a role in lysosome motility. In neurons, mediates the anterograde axonal long-range transport of presynaptic lysosome-related vesicles required for presynaptic biogenesis and synaptic function. May play a role in chromosome segregation.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 21.4 kDa
• AA Sequence: MIALFNKLLDWFKALFWKEEMELTLVGLQYSGKTTFVNVIASGQFNEDMIPTVGFNMRKITKGNVTIKLWDIGGQPRFRSMWERYCRGVSAIVYMVDAADQEKIEASKNELHNLLDKPQLQGIPVLVLGNKRDLPGALDEKELIEKMNLSAIQDREICCYSISCKEKDNIDITLQWLIQHSKSRRSTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: ARL8A ADP-ribosylation factor-like 8A [ Homo sapiens (human) ]
• Official Symbol: ARL8A
• Synonyms: ARL8A; ADP-ribosylation factor-like 8A; ADP ribosylation factor like 10B, ARL10B; ADP-ribosylation factor-like protein 8A; FLJ45195; Gie2; ADP-ribosylation factor-like 10B; novel small G protein indispensable for equal chromosome segregation 2; GIE2; ARL10B
• Gene ID: 127829
• mRNA Refseq: NM_138795
• Protein Refseq: NP_620150
• MIM: 616597
• UniProt ID: Q96BM9