Recombinant Human ARL8A protein, GST-tagged

• Cat.No.: ARL8A-823H
• Product Overview: Human ARL8A full-length ORF ( NP_620150.1, 1 a.a. - 186 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: ARL8A (ADP Ribosylation Factor Like GTPase 8A) is a Protein Coding gene. Among its related pathways are Immune System. GO annotations related to this gene include GTP binding and signal transducer activity. An important paralog of this gene is ARL8B.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 47.8 kDa
• AA Sequence: MIALFNKLLDWFKALFWKEEMELTLVGLQYSGKTTFVNVIASGQFNEDMIPTVGFNMRKITKGNVTIKLWDIGGQPRFRSMWERYCRGVSAIVYMVDAADQEKIEASKNELHNLLDKPQLQGIPVLVLGNKRDLPGALDEKELIEKMNLSAIQDREICCYSISCKEKDNIDITLQWLIQHSKSRRS
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ARL8A ADP-ribosylation factor-like 8A [ Homo sapiens ]
• Official Symbol: ARL8A
• Synonyms: ARL8A; ADP-ribosylation factor-like 8A; ADP ribosylation factor like 10B , ARL10B; ADP-ribosylation factor-like protein 8A; FLJ45195; Gie2; ADP-ribosylation factor-like 10B; novel small G protein indispensable for equal chromosome segregation 2; GIE2; ARL10B
• Gene ID: 127829
• mRNA Refseq: NM_001256129
• Protein Refseq: NP_001243058
• UniProt ID: Q96BM9