Recombinant Human ARL6 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: ARL6-5531H
• Product Overview: ARL6 MS Standard C13 and N15-labeled recombinant protein (NP_115522) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: The protein encoded by this gene belongs to the ARF-like (ADP ribosylation factor-like) sub-family of the ARF family of GTP-binding proteins which are involved in regulation of intracellular traffic. Mutations in this gene are associated with Bardet-Biedl syndrome (BBS). A vision-specific transcript, encoding long isoform BBS3L, has been described (PMID: 20333246).
• Molecular Mass: 21.1 kDa
• AA Sequence: MGLLDRLSVLLGLKKKEVHVLCLGLDNSGKTTIINKLKPSNAQSQNILPTIGFSIEKFKSSSLSFTVFDMSGQGRYRNLWEHYYKEGQAIIFVIDSSDRLRMVVAKEELDTLLNHPDIKHRRIPILFFANKMDLRDAVTSVKVSQLLCLENIKDKPWHICASDAIKGEGLQEGVDWLQDQIQTVKTTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: ARL6 ADP-ribosylation factor-like 6 [ Homo sapiens (human) ]
• Official Symbol: ARL6
• Synonyms: ARL6; ADP-ribosylation factor-like 6; BBS3; RP55; ADP-ribosylation factor-like protein 6; Bardet-Biedl syndrome 3 protein
• Gene ID: 84100
• mRNA Refseq: NM_032146
• Protein Refseq: NP_115522
• MIM: 608845