Recombinant Human ARL5B, His-tagged

• Cat.No.: ARL5B-26184TH
• Product Overview: Recombinant full-length Human ARL5B with a N terminal His tag; 199aa, 23 kDa.

Specification

• Description: ARL5B (ARL8) belongs to a family of proteins that are structurally similar to ADP-ribosylation factors (ARFs; see MIM 103180). ARLs and ARFs are part of the RAS superfamily of regulatory GTPases.
• Protein length: 299 amino acids
• Conjugation: HIS
• Molecular Weight: 22.500kDa inclusive of tags
• Source: E. coli
• Form: Liquid
• Purity: >90% by SDS-PAGE
• Storage buffer: pH: 8.00Constituents:0.32% Tris HCl, 0.04% DTT, 30% Glycerol, 0.58% Sodium chloride, 0.03% EDTA
• Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMGLIFAKLWSLFCNQEHKVIIVGLDNAGKTTILYQFLMNEVVHTSPTIGSNVEEIVVKNTHFLMWDIGGQESLRSSWNTYYSNTEFIILVVDSIDRERLAITKEELYRMLAHEDLRKAAVLIFANKQDMKGCMTAAEISKYLTLSSIKDHPWHIQSCCALTGEGLCQGLEWMTSRIGVR
• Sequence Similarities: Belongs to the small GTPase superfamily. Arf family.

Gene Information

• Gene Name: ARL5B ADP-ribosylation factor-like 5B [ Homo sapiens ]
• Official Symbol: ARL5B
• Synonyms: ARL5B; ADP-ribosylation factor-like 5B; ADP ribosylation factor like 8 , ARL8; ADP-ribosylation factor-like protein 5B
• Gene ID: 221079
• mRNA Refseq: NM_178815
• Protein Refseq: NP_848930
• MIM: 608909
• Uniprot ID: Q96KC2
• Chromosome Location: 10p13
• Function: GTP binding; nucleotide binding