Recombinant Human ARL5B protein, GST-tagged
Cat.No. : | ARL5B-815H |
Product Overview : | Human ARL5B full-length ORF ( NP_848930.1, 1 a.a. - 179 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | ARL5B (ARL8) belongs to a family of proteins that are structurally similar to ADP-ribosylation factors (ARFs; see MIM 103180). ARLs and ARFs are part of the RAS superfamily of regulatory GTPases.[supplied by OMIM, Nov 2010] |
Molecular Mass : | 46.8 kDa |
AA Sequence : | MGLIFAKLWSLFCNQEHKVIIVGLDNAGKTTILYQFLMNEVVHTSPTIGSNVEEIVVKNTHFLMWDIGGQESLRSSWNTYYSNTEFIILVVDSIDRERLAITKEELYRMLAHEDLRKAAVLIFANKQDMKGCMTAAEISKYLTLSSIKDHPWHIQSCCALTGEGLCQGLEWMTSRIGVR |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ARL5B ADP-ribosylation factor-like 5B [ Homo sapiens ] |
Official Symbol | ARL5B |
Synonyms | ARL5B; ADP-ribosylation factor-like 5B; ADP ribosylation factor like 8 , ARL8; ADP-ribosylation factor-like protein 5B; ADP-ribosylation factor-like 8; ADP-ribosylation-like factor 8; ADP-ribosylation factor-like protein 8; ARL8; |
Gene ID | 221079 |
mRNA Refseq | NM_178815 |
Protein Refseq | NP_848930 |
MIM | 608909 |
UniProt ID | Q96KC2 |
◆ Recombinant Proteins | ||
ARL5B-9860H | Recombinant Human ARL5B, GST-tagged | +Inquiry |
ARL8-822H | Recombinant Human ARL8 protein, GST-tagged | +Inquiry |
ARL5B-3614H | Recombinant Human ARL5B, His-tagged | +Inquiry |
ARL5B-1424HF | Recombinant Full Length Human ARL5B Protein, GST-tagged | +Inquiry |
ARL5B-3903C | Recombinant Chicken ARL5B | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARL5B-8709HCL | Recombinant Human ARL5B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ARL5B Products
Required fields are marked with *
My Review for All ARL5B Products
Required fields are marked with *
0
Inquiry Basket