Recombinant Human ARL5B protein, GST-tagged

• Cat.No.: ARL5B-815H
• Product Overview: Human ARL5B full-length ORF ( NP_848930.1, 1 a.a. - 179 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: ARL5B (ARL8) belongs to a family of proteins that are structurally similar to ADP-ribosylation factors (ARFs; see MIM 103180). ARLs and ARFs are part of the RAS superfamily of regulatory GTPases.[supplied by OMIM, Nov 2010]
• Molecular Mass: 46.8 kDa
• AA Sequence: MGLIFAKLWSLFCNQEHKVIIVGLDNAGKTTILYQFLMNEVVHTSPTIGSNVEEIVVKNTHFLMWDIGGQESLRSSWNTYYSNTEFIILVVDSIDRERLAITKEELYRMLAHEDLRKAAVLIFANKQDMKGCMTAAEISKYLTLSSIKDHPWHIQSCCALTGEGLCQGLEWMTSRIGVR
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ARL5B ADP-ribosylation factor-like 5B [ Homo sapiens ]
• Official Symbol: ARL5B
• Synonyms: ARL5B; ADP-ribosylation factor-like 5B; ADP ribosylation factor like 8 , ARL8; ADP-ribosylation factor-like protein 5B; ADP-ribosylation factor-like 8; ADP-ribosylation-like factor 8; ADP-ribosylation factor-like protein 8; ARL8
• Gene ID: 221079
• mRNA Refseq: NM_178815
• Protein Refseq: NP_848930
• MIM: 608909
• UniProt ID: Q96KC2