Recombinant Human ARL5A Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | ARL5A-3819H |
Product Overview : | ARL5A MS Standard C13 and N15-labeled recombinant protein (NP_001032251) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene belongs to the ARF family of GTP-binding proteins. With its distinctive nuclear/nucleolar localization and interaction with HP1alpha, the protein is developmentally regulated and may play a role(s) in nuclear dynamics and/or signaling cascades during embryonic development. Alternative splicing results in multiple transcript variants encoding different isoforms. This gene has multiple pseudogenes. |
Molecular Mass : | 20.73 kDa |
AA Sequence : | MGILFTRIWRLFNHQEHKVIIVGLDNAGKTTILYQFSMNEVVHTSPTIGSNVEEIVINNTRFLMWDIGGQESLRSSWNTYYTNTEFVIVVVDSTDRERISVTREELYKMLAHEDLRKAGLLIFANKQDVKECMTVAEISQFLKLTSIKDHQWHIQACCALTGEGLCQGLEWMMSRLKIRTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | ARL5A ADP-ribosylation factor-like 5A [ Homo sapiens (human) ] |
Official Symbol | ARL5A |
Synonyms | ARL5A; ADP-ribosylation factor-like 5A; ADP ribosylation factor like 5, ARL5; ADP-ribosylation factor-like protein 5A; ADP-ribosylation factor-like 5; ADP-ribosylation factor-like protein 5; ARL5; ARFLP5; |
Gene ID | 26225 |
mRNA Refseq | NM_001037174 |
Protein Refseq | NP_001032251 |
MIM | 608960 |
UniProt ID | Q9Y689 |
◆ Recombinant Proteins | ||
Arl5a-1708M | Recombinant Mouse Arl5a Protein, Myc/DDK-tagged | +Inquiry |
ARL5A-938H | Recombinant Human ADP-ribosylation Factor-like 5A, His-tagged | +Inquiry |
ARL5A-3819H | Recombinant Human ARL5A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ARL5A-440R | Recombinant Rat ARL5A Protein, His (Fc)-Avi-tagged | +Inquiry |
ARL5A-488Z | Recombinant Zebrafish ARL5A | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARL5A-8710HCL | Recombinant Human ARL5A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ARL5A Products
Required fields are marked with *
My Review for All ARL5A Products
Required fields are marked with *
0
Inquiry Basket