Recombinant Human ARL5A Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: ARL5A-3819H
• Product Overview: ARL5A MS Standard C13 and N15-labeled recombinant protein (NP_001032251) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: The protein encoded by this gene belongs to the ARF family of GTP-binding proteins. With its distinctive nuclear/nucleolar localization and interaction with HP1alpha, the protein is developmentally regulated and may play a role(s) in nuclear dynamics and/or signaling cascades during embryonic development. Alternative splicing results in multiple transcript variants encoding different isoforms. This gene has multiple pseudogenes.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 20.73 kDa
• AA Sequence: MGILFTRIWRLFNHQEHKVIIVGLDNAGKTTILYQFSMNEVVHTSPTIGSNVEEIVINNTRFLMWDIGGQESLRSSWNTYYTNTEFVIVVVDSTDRERISVTREELYKMLAHEDLRKAGLLIFANKQDVKECMTVAEISQFLKLTSIKDHQWHIQACCALTGEGLCQGLEWMMSRLKIRTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: ARL5A ADP-ribosylation factor-like 5A [ Homo sapiens (human) ]
• Official Symbol: ARL5A
• Synonyms: ARL5A; ADP-ribosylation factor-like 5A; ADP ribosylation factor like 5, ARL5; ADP-ribosylation factor-like protein 5A; ADP-ribosylation factor-like 5; ADP-ribosylation factor-like protein 5; ARL5; ARFLP5
• Gene ID: 26225
• mRNA Refseq: NM_001037174
• Protein Refseq: NP_001032251
• MIM: 608960
• UniProt ID: Q9Y689