Recombinant Human ARL5A, His-tagged

• Cat.No.: ARL5A-26181TH
• Product Overview: Recombinant full length Human ARL5A with an N terminal His tag; 203 amino acids with tag, Predicted MWt 23.3 kDa.

Specification

• Description: The protein encoded by this gene belongs to the ARF family of GTP-binding proteins. With its distinctive nuclear/nucleolar localization and interaction with HP1alpha, the protein is developmentally regulated and may play a role(s) in nuclear dynamics and/or signaling cascades during embryonic development. Alternative splicing results in multiple transcript variants encoding different isoforms. This gene has multiple pseudogenes.
• Protein length: 179 amino acids
• Conjugation: HIS
• Molecular Weight: 23.300kDa inclusive of tags
• Source: E. coli
• Form: Liquid
• Purity: >90% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 20% Glycerol, 20mM Tris HCl, 2mM DTT, 0.2mM PMSF, pH 8.0
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMGSHMGILFTRIWRLFNHQEHKVIIVGLDNAGKTTILYQFSMNEVVHTSPTIGSNVEEIVINNTRFLMWDIGGQESLRSSWNTYYTNTEFVIVVVDSTDRERISVTREELYKMLAHEDLRKAGLLIFANKQDVKECMTVAEISQFLKLTSIKDHQWHIQACCALTGEGLCQGLEWMMSRLKIR

Gene Information

• Gene Name: ARL5A ADP-ribosylation factor-like 5A [ Homo sapiens ]
• Official Symbol: ARL5A
• Synonyms: ARL5A; ADP-ribosylation factor-like 5A; ADP ribosylation factor like 5 , ARL5; ADP-ribosylation factor-like protein 5A
• Gene ID: 26225
• mRNA Refseq: NM_001037174
• Protein Refseq: NP_001032251
• MIM: 608960
• Uniprot ID: Q9Y689
• Chromosome Location: 2q23.3
• Function: GTP binding; nucleotide binding