Recombinant Human ARL4C Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : ARL4C-5698H
Product Overview : ARL4C MS Standard C13 and N15-labeled recombinant protein (NP_005728) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : ADP-ribosylation factor-like 4C is a member of the ADP-ribosylation factor family of GTP-binding proteins. ARL4C is closely similar to ARL4A and ARL4D and each has a nuclear localization signal and an unusually high guanine nucleotide exchange rate. This protein may play a role in cholesterol transport.
Source : HEK293
Species : Human
Tag : Myc&DDK
Molecular Mass : 21.5 kDa
AA Sequence : MGNISSNISAFQSLHIVMLGLDSAGKTTVLYRLKFNEFVNTVPTIGFNTEKIKLSNGTAKGISCHFWDVGGQEKLRPLWKSYSRCTDGIIYVVDSVDVDRLEEAKTELHKVTKFAENQGTPLLVIANKQDLPKSLPVAEIEKQLALHELIPATTYHVQPACAIIGEGLTEGMDKLYEMILKRRKSLKQKKKRTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name ARL4C ADP-ribosylation factor-like 4C [ Homo sapiens (human) ]
Official Symbol ARL4C
Synonyms ARL4C; ADP-ribosylation factor-like 4C; LAK; ARL7; ADP-ribosylation factor-like protein 4C; ADP ribosylation factor-like protein 7; ADP-ribosylation factor-like 4C; ADP-ribosylation factor-like 7; ADP-ribosylation factor-like protein LAK
Gene ID 10123
mRNA Refseq NM_005737
Protein Refseq NP_005728
MIM 604787
UniProt ID P56559

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ARL4C Products

Required fields are marked with *

My Review for All ARL4C Products

Required fields are marked with *

0

Inquiry Basket

cartIcon