Recombinant Human ARL4C Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: ARL4C-5698H
• Product Overview: ARL4C MS Standard C13 and N15-labeled recombinant protein (NP_005728) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: ADP-ribosylation factor-like 4C is a member of the ADP-ribosylation factor family of GTP-binding proteins. ARL4C is closely similar to ARL4A and ARL4D and each has a nuclear localization signal and an unusually high guanine nucleotide exchange rate. This protein may play a role in cholesterol transport.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 21.5 kDa
• AA Sequence: MGNISSNISAFQSLHIVMLGLDSAGKTTVLYRLKFNEFVNTVPTIGFNTEKIKLSNGTAKGISCHFWDVGGQEKLRPLWKSYSRCTDGIIYVVDSVDVDRLEEAKTELHKVTKFAENQGTPLLVIANKQDLPKSLPVAEIEKQLALHELIPATTYHVQPACAIIGEGLTEGMDKLYEMILKRRKSLKQKKKRTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: ARL4C ADP-ribosylation factor-like 4C [ Homo sapiens (human) ]
• Official Symbol: ARL4C
• Synonyms: ARL4C; ADP-ribosylation factor-like 4C; LAK; ARL7; ADP-ribosylation factor-like protein 4C; ADP ribosylation factor-like protein 7; ADP-ribosylation factor-like 4C; ADP-ribosylation factor-like 7; ADP-ribosylation factor-like protein LAK
• Gene ID: 10123
• mRNA Refseq: NM_005737
• Protein Refseq: NP_005728
• MIM: 604787
• UniProt ID: P56559