Recombinant Human ARL4C protein, GST-tagged

• Cat.No.: ARL4C-812H
• Product Overview: Human ARL4C full-length ORF ( NP_005728.2, 1 a.a. - 192 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: ADP-ribosylation factor-like 4C is a member of the ADP-ribosylation factor family of GTP-binding proteins. ARL4C is closely similar to ARL4A and ARL4D and each has a nuclear localization signal and an unusually high guanine nucleotide exchange rate. This protein may play a role in cholesterol transport. [provided by RefSeq, Jul 2008]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 47.9 kDa
• AA Sequence: MGNISSNISAFQSLHIVMLGLDSAGKTTVLYRLKFNEFVNTVPTIGFNTEKIKLSNGTAKGISCHFWDVGGQEKLRPLWKSYSRCTDGIIYVVDSVDVDRLEEAKTELHKVTKFAENQGTPLLVIANKQDLPKSLPVAEIEKQLALHELIPATTYHVQPACAIIGEGLTEGMDKLYEMILKRRKSLKQKKKR
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ARL4C ADP-ribosylation factor-like 4C [ Homo sapiens ]
• Official Symbol: ARL4C
• Synonyms: LAK; ARL7
• Gene ID: 10123
• mRNA Refseq: NM_005737.3
• Protein Refseq: NP_005728.2
• MIM: 604787
• UniProt ID: P56559