Recombinant Human ARL4A protein, His-tagged

• Cat.No.: ARL4A-2550H
• Product Overview: Recombinant Human ARL4A protein(P40617)(2-200aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 2-200aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 26.5 kDa
• AA Sequence: GNGLSDQTSILSNLPSFQSFHIVILGLDCAGKTTVLYRLQFNEFVNTVPTKGFNTEKIKVTLGNSKTVTFHFWDVGGQEKLRPLWKSYTRCTDGIVFVVDSVDVERMEEAKTELHKITRISENQGVPVLIVANKQDLRNSLSLSEIEKLLAMGELSSSTPWHLQPTCAIIGDGLKEGLEKLHDMIIKRRKMLRQQKKKR
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: ARL4A ADP-ribosylation factor-like 4A [ Homo sapiens ]
• Official Symbol: ARL4A
• Synonyms: ARL4A; ADP-ribosylation factor-like 4A; ADP ribosylation factor like 4 , ARL4; ADP-ribosylation factor-like protein 4A; ADP-ribosylation factor-like 4; ARL4
• Gene ID: 10124
• mRNA Refseq: NM_001037164
• Protein Refseq: NP_001032241
• MIM: 604786
• UniProt ID: P40617