Recombinant Human ARL4A protein, T7-tagged

• Cat.No.: ARL4A-193H
• Product Overview: Recombinant human ARL4A (200 aa) fused with T7 Tag at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: T7
• Protein Length: 200 a.a.
• Form: 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
• AA Sequence: MASMTGGQQMGRGEFMGNGLSDQTSILSNLPSFQSFHIVILGLDCAGKTTVLYRLQFNEFVNTVPTKGFNTEKIK VTLGNSKTVTFHFWDVGGQEKLRPLWKSYTRCTDGIVFVVDSVDVERMEEAKTELHKITRISENQGVPVLIVANK QDLRNSLSLSEIEKLLAMGELSSSTPWHLQPTCAIIGDGLKEGLEKLHDMIIKRRKMLRQQKKKR
• Purity: >90% by SDS-PAGE.
• Storage: Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days.

Gene Information

• Gene Name: ARL4A ADP-ribosylation factor-like 4A [ Homo sapiens ]
• Official Symbol: ARL4A
• Synonyms: ARL4A; ADP-ribosylation factor-like 4A; ADP ribosylation factor like 4 , ARL4; ADP-ribosylation factor-like protein 4A; ADP-ribosylation factor-like 4; ARL4
• Gene ID: 10124
• mRNA Refseq: NM_001037164
• Protein Refseq: NP_001032241
• MIM: 604786
• UniProt ID: P40617
• Chromosome Location: 7p21.3
• Function: GTP binding; nucleotide binding; protein binding