Recombinant Human ARL2 protein, GST-tagged
Cat.No. : | ARL2-808H |
Product Overview : | Human ARL2 full-length ORF ( AAH02530, 1 a.a. - 184 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | ARL5B (ARL8) belongs to a family of proteins that are structurally similar to ADP-ribosylation factors (ARFs; see MIM 103180). ARLs and ARFs are part of the RAS superfamily of regulatory GTPases.[supplied by OMIM, Nov 2010] |
Molecular Mass : | 45.98 kDa |
AA Sequence : | MGLLTILKKMKQKERELRLLMLGLDNAGKTTILKKFNGEDIDTISPTLGFNIKTLEHRGFKLNIWDVGGQKSLRSYWRNYFESTDGLIWVVDSADRQRMQDCQRELQSLLVEERLAGATLLIFANKQDLPGALSSNAIREVLELDSIRSHHWCIQGCSAVTGENLLPGIDWLLDDISSRIFTAD |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ARL2 ADP-ribosylation factor-like 2 [ Homo sapiens ] |
Official Symbol | ARL2 |
Synonyms | ARL2; ADP-ribosylation factor-like 2; ADP-ribosylation factor-like protein 2; ARFL2; |
Gene ID | 402 |
mRNA Refseq | NM_001199745 |
Protein Refseq | NP_001186674 |
MIM | 601175 |
UniProt ID | P36404 |
◆ Recombinant Proteins | ||
ARL2-780R | Recombinant Rat ARL2 Protein | +Inquiry |
ARL2-5159H | Recombinant Human ARL2 protein, GST-tagged | +Inquiry |
ARL2-720M | Recombinant Mouse ARL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
ARL2-2117H | Recombinant Human ARL2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ARL2-808H | Recombinant Human ARL2 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARL2-8716HCL | Recombinant Human ARL2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ARL2 Products
Required fields are marked with *
My Review for All ARL2 Products
Required fields are marked with *
0
Inquiry Basket