Recombinant Human ARL14 Protein, GST-tagged
Cat.No. : | ARL14-4276H |
Product Overview : | Human FLJ22595 full-length ORF ( AAH34354, 1 a.a. - 192 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | ARL14 (ADP Ribosylation Factor Like GTPase 14) is a Protein Coding gene. GO annotations related to this gene include GTP binding and signal transducer activity. An important paralog of this gene is ARL11. |
Molecular Mass : | 46.86 kDa |
AA Sequence : | MGSLGSKNPQTKQAQVLLLGLDSAGKSTLLYKLKLAKDITTIPTIGFNVEMIELERNFSLTVWDVGGQEKMRTVWGCYCENTDGLVYVVDSTDKQRLEESQRQFEHILKNEHIKNVPVVLLANKQDMPGALTAEDITRMFKVKKLCSDRNWYVQPCCALTGEGLAQGFRKLTGFVKSHMKSRGDTLAFFKQN |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ARL14 ADP-ribosylation factor-like 14 [ Homo sapiens ] |
Official Symbol | ARL14 |
Synonyms | ARL14; ADP-ribosylation factor-like 14; ADP ribosylation factor 7, ARF7; ADP-ribosylation factor-like protein 14; FLJ22595; ADP-ribosylation factor 7; ARF7; |
Gene ID | 80117 |
mRNA Refseq | NM_025047 |
Protein Refseq | NP_079323 |
MIM | 614439 |
UniProt ID | Q8N4G2 |
◆ Recombinant Proteins | ||
ARL14-4933HF | Recombinant Full Length Human ARL14 Protein, GST-tagged | +Inquiry |
Arl14-1704M | Recombinant Mouse Arl14 Protein, Myc/DDK-tagged | +Inquiry |
ARL14-27187TH | Recombinant Human ARL14, His-tagged | +Inquiry |
ARL14-5795Z | Recombinant Zebrafish ARL14 | +Inquiry |
ARL14-4276H | Recombinant Human ARL14 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARL14-8719HCL | Recombinant Human ARL14 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ARL14 Products
Required fields are marked with *
My Review for All ARL14 Products
Required fields are marked with *
0
Inquiry Basket