Recombinant Full Length Human ARL14 Protein, GST-tagged

• Cat.No.: ARL14-4933HF
• Product Overview: Human FLJ22595 full-length ORF ( AAH34354, 1 a.a. - 192 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: ARL14 (ADP Ribosylation Factor Like GTPase 14) is a Protein Coding gene. GO annotations related to this gene include GTP binding and signal transducer activity. An important paralog of this gene is ARL11.
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 46.86 kDa
• Protein length: 192 amino acids
• AA Sequence: MGSLGSKNPQTKQAQVLLLGLDSAGKSTLLYKLKLAKDITTIPTIGFNVEMIELERNFSLTVWDVGGQEKMRTVWGCYCENTDGLVYVVDSTDKQRLEESQRQFEHILKNEHIKNVPVVLLANKQDMPGALTAEDITRMFKVKKLCSDRNWYVQPCCALTGEGLAQGFRKLTGFVKSHMKSRGDTLAFFKQN
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ARL14 ADP-ribosylation factor-like 14 [ Homo sapiens ]
• Official Symbol: ARL14
• Synonyms: ARL14; ADP-ribosylation factor-like 14; ADP ribosylation factor 7, ARF7; ADP-ribosylation factor-like protein 14; FLJ22595; ADP-ribosylation factor 7; ARF7
• Gene ID: 80117
• mRNA Refseq: NM_025047
• Protein Refseq: NP_079323
• MIM: 614439
• UniProt ID: Q8N4G2