Recombinant Human ARL10 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: ARL10-2480H
• Product Overview: ARL10 MS Standard C13 and N15-labeled recombinant protein (NP_775935) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: ARL10 (ADP Ribosylation Factor Like GTPase 10) is a Protein Coding gene. Diseases associated with ARL10 include Martsolf Syndrome. Gene Ontology (GO) annotations related to this gene include GTP binding. An important paralog of this gene is ARL9.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 27.3 kDa
• AA Sequence: MAPRPLGPLVLALGGAAAVLGSVLFILWKTYFGRGRERRWDRGEAWWGAEAARLPEWDEWDPEDEEDEEPALEELEQREVLVLGLDGAGKSTFLRVLSGKPPLEGHIPTWGFNSVRLPTKDFEVDLLEIGGSQNLRFYWKEFVSEVDVLVFVVDSADRLRLPWARQELHKLLDKDPDLPVVVVANKQDLSEAMSMGELQRELGLQAIDNQREVFLLAASIAPAGPTFEEPGTVHIWKLLLELLSTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: ARL10 ADP-ribosylation factor-like 10 [ Homo sapiens (human) ]
• Official Symbol: ARL10
• Synonyms: ARL10; ADP-ribosylation factor-like 10; ADP ribosylation factor like 10A, ARL10A; ADP-ribosylation factor-like protein 10; ADP-ribosylation factor-like 10A; ADP-ribosylation factor-like membrane-associated protein; ARL10A; FLJ39249
• Gene ID: 285598
• mRNA Refseq: NM_173664
• Protein Refseq: NP_775935
• UniProt ID: Q8N8L6