Recombinant Human ARL1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : ARL1-4774H
Product Overview : ARL1 MS Standard C13 and N15-labeled recombinant protein (NP_001168) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The protein encoded by this gene belongs to the ARL (ADP-ribosylation factor-like) family of proteins, which are structurally related to ADP-ribosylation factors (ARFs). ARFs, described as activators of cholera toxin (CT) ADP-ribosyltransferase activity, regulate intracellular vesicular membrane trafficking, and stimulate a phospholipase D (PLD) isoform. Although, ARL proteins were initially thought not to activate CT or PLD, later work showed that they are weak stimulators of PLD and CT in a phospholipid dependent manner. Alternative splicing results in multiple transcript variants encoding different isoforms.
Molecular Mass : 20.4 kDa
AA Sequence : MGGFFSSIFSSLFGTREMRILILGLDGAGKTTILYRLQVGEVVTTIPTIGFNVETVTYKNLKFQVWDLGGQTSIRPYWRCYYSNTDAVIYVVDSCDRDRIGISKSELVAMLEEEELRKAILVVFANKQDMEQAMTSSEMANSLGLPALKDRKWQIFKTSATKGTGLDEAMEWLVETLKSRQTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name ARL1 ADP-ribosylation factor-like 1 [ Homo sapiens (human) ]
Official Symbol ARL1
Synonyms ARL1; ADP-ribosylation factor-like 1; ADP-ribosylation factor-like protein 1; ARFL1;
Gene ID 400
mRNA Refseq NM_001177
Protein Refseq NP_001168
MIM 603425
UniProt ID P40616

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ARL1 Products

Required fields are marked with *

My Review for All ARL1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon