Recombinant Human ARID4B protein, His-tagged

• Cat.No.: ARID4B-4497H
• Product Overview: Recombinant Human ARID4B protein(Q4LE39)(167-415aa), fused to N-terminal His tag, was expressed in E. coli

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 32.8 kDa
• Protein length: 167-415aa
• AA Sequence: KQIDELLGKVVCVDYISLDKKKALWFPALVVCPDCSDEIAVKKDNILVRSFKDGKFTSVPRKDVHEITSDTAPKPDAVLKQAFEQALEFHKSRTIPANWKTELKEDSSSSEAEEEEEEEDDEKEKEDNSSEEEEEIEPFPEERENFLQQLYKFMEDRGTPINKRPVLGYRNLNLFKLFRLVHKLGGFDNIESGAVWKQVYQDLGIPVLNSAAGYNVKCAYKKYLYGFEEYCRSANIEFQMALPEKVVNK
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: ARID4B AT rich interactive domain 4B (RBP1-like) [ Homo sapiens ]
• Official Symbol: ARID4B
• Synonyms: ARID4B; AT rich interactive domain 4B (RBP1-like); AT rich interactive domain 4B (RBP1 like) , RBP1L1, retinoblastoma binding protein 1 like 1; AT-rich interactive domain-containing protein 4B; BCAA; BRCAA1; SAP180; Rb-binding protein homolog; SIN3A-associated protein 180; sin3-associated polypeptide p180; ARID domain-containing protein 4B; breast cancer-associated antigen 1; 180 kDa Sin3-associated polypeptide; breast carcinoma-associated antigen; breast cancer-associated antigen BRCAA1; retinoblastoma-binding protein 1-like 1; histone deacetylase complex subunit SAP180; RBP1L1; RBBP1L1; MGC163290; DKFZp313M2420
• Gene ID: 51742
• mRNA Refseq: NM_001206794
• Protein Refseq: NP_001193723
• MIM: 609696
• UniProt ID: Q4LE39