Recombinant Human ARID4B protein, GST-tagged

• Cat.No.: ARID4B-3658H
• Product Overview: Recombinant Human ARID4B protein(406-523 aa), fused to GST tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: GST
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
• Protein length: 406-523 aa
• AA Sequence: MALPEKVVNKQCKECENVKEIKVKEENETEIKEIKMEEERNIIPREEKPIEDEIERKENIKPSLGSKKNLLESIPTHSDQEKEVNIKKPEDNENLDDKDDDTTRVDESLNIKVEAEEE
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: ARID4B AT rich interactive domain 4B (RBP1-like) [ Homo sapiens ]
• Official Symbol: ARID4B
• Synonyms: ARID4B; AT rich interactive domain 4B (RBP1-like); AT rich interactive domain 4B (RBP1 like) , RBP1L1, retinoblastoma binding protein 1 like 1; AT-rich interactive domain-containing protein 4B; BCAA; BRCAA1; SAP180; Rb-binding protein homolog; SIN3A-associated protein 180; sin3-associated polypeptide p180; ARID domain-containing protein 4B; breast cancer-associated antigen 1; 180 kDa Sin3-associated polypeptide; breast carcinoma-associated antigen; breast cancer-associated antigen BRCAA1; retinoblastoma-binding protein 1-like 1; histone deacetylase complex subunit SAP180; RBP1L1; RBBP1L1; MGC163290; DKFZp313M2420
• Gene ID: 51742
• mRNA Refseq: NM_001206794
• Protein Refseq: NP_001193723
• MIM: 609696
• UniProt ID: Q4LE39