Recombinant Human ARHGEF7 protein, His-tagged

• Cat.No.: ARHGEF7-3594H
• Product Overview: Recombinant Human ARHGEF7 protein(42-193 aa), fused to His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• Protein length: 42-193 aa
• AA Sequence: CRLLERLLPGTIEKVYPEPRSESECLSNIREFLRGCGASLRLELLFPPSQPPQHLVTTILLSASTFDANDLYQGQNFNKVLSSLVTLNKVTADIGLGSDSVCARPSSHRIKSFDSLGSQSLHTRTSKLFQGQYRSLDMTDNSNNQLVVRAKF
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: ARHGEF7 Rho guanine nucleotide exchange factor (GEF) 7 [ Homo sapiens ]
• Official Symbol: ARHGEF7
• Synonyms: ARHGEF7; Rho guanine nucleotide exchange factor (GEF) 7; rho guanine nucleotide exchange factor 7; BETA PIX; COOL1; DKFZp686C12170; DKFZp761K1021; guanine nucleotide exchange factor 7; KIAA0142; Nbla10314; P50; P50BP; P85; P85COOL1; P85SPR; PAK interacting exchange factor beta; PAK3; PIXB; rho; SH3 domain containing proline rich protein; PAK-interacting exchange factor beta; SH3 domain-containing proline-rich protein; COOL-1; BETA-PIX
• Gene ID: 8874
• mRNA Refseq: NM_001113511
• Protein Refseq: NP_001106983
• MIM: 605477
• UniProt ID: Q14155