Recombinant Human ARHGEF18 protein, GST-tagged
Cat.No. : | ARHGEF18-783H |
Product Overview : | Human ARHGEF18 full-length ORF ( AAH08016.1, 1 a.a. - 89 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Rho GTPases are GTP binding proteins that regulate a wide spectrum of cellular functions. These cellular processes include cytoskeletal rearrangements, gene transcription, cell growth and motility. Activation of Rho GTPases is under the direct control of guanine nucleotide exchange factors (GEFs). The protein encoded by this gene is a guanine nucleotide exchange factor and belongs to the Rho GTPase GFE family. Family members share a common feature, a Dbl (DH) homology domain followed by a pleckstrin (PH) homology domain. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Oct 2008] |
Molecular Mass : | 35.8 kDa |
AA Sequence : | MSQGMQRMHLETLQQVDKWPLCGPLACSELLQLTVRSLEGWRKEVLGSIKGAGTSQGGEIHPRSSSGGERAHVKPCSAPQALVVGLGPG |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ARHGEF18 Rho/Rac guanine nucleotide exchange factor (GEF) 18 [ Homo sapiens ] |
Official Symbol | ARHGEF18 |
Synonyms | ARHGEF18; Rho/Rac guanine nucleotide exchange factor (GEF) 18; rho/rac guanine nucleotide exchange factor (GEF) 18; rho guanine nucleotide exchange factor 18; KIAA0521; MGC15913; P114 RhoGEF; Rho specific guanine nucleotide exchange factor p114; SA-RhoGEF; p114RhoGEF; P114-RHO-GEF; septin-associated RhoGEF; Rho/Rac guanine nucleotide exchange factor 18; Rho-specific guanine nucleotide exchange factor p114; 114 kDa Rho-specific guanine nucleotide exchange factor; P114-RhoGEF; |
Gene ID | 23370 |
mRNA Refseq | NM_001130955 |
Protein Refseq | NP_001124427 |
UniProt ID | Q6ZSZ5 |
◆ Recombinant Proteins | ||
ARHGEF18-694M | Recombinant Mouse ARHGEF18 Protein, His (Fc)-Avi-tagged | +Inquiry |
ARHGEF18-9836H | Recombinant Human ARHGEF18, GST-tagged | +Inquiry |
ARHGEF18-783H | Recombinant Human ARHGEF18 protein, GST-tagged | +Inquiry |
ARHGEF18-1893M | Recombinant Mouse ARHGEF18 Protein | +Inquiry |
ARHGEF18-1149HF | Recombinant Full Length Human ARHGEF18 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ARHGEF18 Products
Required fields are marked with *
My Review for All ARHGEF18 Products
Required fields are marked with *
0
Inquiry Basket