Recombinant Human ARHGEF11 protein, GST-tagged

• Cat.No.: ARHGEF11-780H
• Product Overview: Human ARHGEF11 partial ORF ( AAH57394, 651 a.a. - 750 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: Rho GTPases play a fundamental role in numerous cellular processes that are initiated by extracellular stimuli that work through G protein coupled receptors. The encoded protein may form a complex with G proteins and stimulate Rho-dependent signals. A similar protein in rat interacts with glutamate transporter EAAT4 and modulates its glutamate transport activity. Expression of the rat protein induces the reorganization of the actin cytoskeleton and its overexpression induces the formation of membrane ruffling and filopodia. Two alternative transcripts encoding different isoforms have been described. [provided by RefSeq, Jul 2008]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 36.63 kDa
• AA Sequence: RSESLKGREEMKRSRKAENVPRSRSDVDMDAAAEATRLHQSASSSTSSLSTRSLENPTPPFTPKMGRRSIESPSLGFCTDTLLPHLLEDDLGQLSDLEPE
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ARHGEF11 Rho guanine nucleotide exchange factor (GEF) 11 [ Homo sapiens ]
• Official Symbol: ARHGEF11
• Synonyms: ARHGEF11; Rho guanine nucleotide exchange factor (GEF) 11; rho guanine nucleotide exchange factor 11; GTRAP48; KIAA0380; PDZ RHOGEF; Rho guanine exchange factor (GEF) 11; RhoGEF glutamate transport modulator; RhoA-specific guanine nucleotide exchange factor; glutamate transporter EAAT4-associated protein 48; PDZ-RHOGEF; DKFZp667F1223
• Gene ID: 9826
• mRNA Refseq: NM_014784
• Protein Refseq: NP_055599
• MIM: 605708
• UniProt ID: O15085