Recombinant Human ARHGDIA protein, GST-tagged
Cat.No. : | ARHGDIA-30124H |
Product Overview : | Recombinant Human ARHGDIA (1-204 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Met1-Asp204 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MAEQEPTAEQLAQIAAENEEDEHSVNYKPPAQKSIQEIQELDKDDESLRKYKEALLGRVAVSADPNVPNVVVTGLTLVCSSAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNREIVSGMKYIQHTYRKGVKIDKTDYMVGSYGPRAEEYEFLTPVEEAPKGMLARGSYSIKSRFTDDDKTDHLSWEWNLTIKKDWKD |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | ARHGDIA Rho GDP dissociation inhibitor alpha [ Homo sapiens (human) ] |
Official Symbol | ARHGDIA |
Synonyms | ARHGDIA; GDIA1; NPHS8; RHOGDI; RHOGDI-1; HEL-S-47e |
Gene ID | 396 |
mRNA Refseq | NM_001185077 |
Protein Refseq | NP_001172006 |
MIM | 601925 |
UniProt ID | P52565 |
◆ Recombinant Proteins | ||
ARHGDIA-12629Z | Recombinant Zebrafish ARHGDIA | +Inquiry |
ARHGDIA-774H | Recombinant Human ARHGDIA protein, GST-tagged | +Inquiry |
ARHGDIA-60C | Recombinant Cynomolgus Monkey ARHGDIA Protein, His (Fc)-Avi-tagged | +Inquiry |
ARHGDIA-1883M | Recombinant Mouse ARHGDIA Protein | +Inquiry |
ARHGDIA-30124H | Recombinant Human ARHGDIA protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARHGDIA-8736HCL | Recombinant Human ARHGDIA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ARHGDIA Products
Required fields are marked with *
My Review for All ARHGDIA Products
Required fields are marked with *
0
Inquiry Basket