Recombinant Human ARHGDIA, His-tagged

Cat.No. : ARHGDIA-30981TH
Product Overview : Recombinant fragment, corresponding to amino acids 6-204 of Human RhoGDI with an N terminal His tag; MWt 25kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 6-204 a.a.
Description : Aplysia Ras-related homologs (ARHs), also called Rho genes, belong to the RAS gene superfamily encoding small guanine nucleotide exchange (GTP/GDP) factors. The ARH proteins may be kept in the inactive, GDP-bound state by interaction with GDP dissociation inhibitors, such as ARHGDIA (Leffers et al.
Conjugation : HIS
Form : Lyophilised:Reconstitute with 156 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : PTAEQLAQIAAENEEDEHSVNYKPPAQKSIQEIQELDKDD ESLRKYKEALLGRVAVSADPNVPNVVVTGLTLVCSSAP GPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNRE IVSGMKYIQHTYRKGVKIDKTDYMVGSYGPRAEEYEFL TPVEEAPKGMLARGSYSIKSRFTDDDKTDHLSWEWNLTIK KDWKD
Sequence Similarities : Belongs to the Rho GDI family.
Gene Name ARHGDIA Rho GDP dissociation inhibitor (GDI) alpha [ Homo sapiens ]
Official Symbol ARHGDIA
Synonyms ARHGDIA; Rho GDP dissociation inhibitor (GDI) alpha; GDIA1; rho GDP-dissociation inhibitor 1; RHOGDI;
Gene ID 396
mRNA Refseq NM_001185077
Protein Refseq NP_001172006
MIM 601925
Uniprot ID P52565
Chromosome Location 17q25.3
Pathway Axonal growth inhibition (RHOA activation), organism-specific biosystem; Axonal growth stimulation, organism-specific biosystem; CDC42 signaling events, organism-specific biosystem; Neurotrophin signaling pathway, organism-specific biosystem; Neurotrophin signaling pathway, conserved biosystem;
Function GTPase activator activity; Rho GDP-dissociation inhibitor activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ARHGDIA Products

Required fields are marked with *

My Review for All ARHGDIA Products

Required fields are marked with *

0

Inquiry Basket

cartIcon