Recombinant Human ARHGAP1
Cat.No. : | ARHGAP1-26235TH |
Product Overview : | Recombinant fragment of Human ARHGAP1 with a N terminal proprietary tag; Predicted MWt 36.63 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Molecular Weight : | 36.630kDa inclusive of tags |
Tissue specificity : | Ubiquitous. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | GFLNIDESQRVPATLQVLQTLPEENYQVLRFLTAFLVQISAHSDQNKMTNTNLAVVFGPNLLWAKDAAITLKAINPINTFTKFLLDHQGELFPSPDPSGL |
Sequence Similarities : | Contains 1 CRAL-TRIO domain.Contains 1 Rho-GAP domain. |
Gene Name | ARHGAP1 Rho GTPase activating protein 1 [ Homo sapiens ] |
Official Symbol | ARHGAP1 |
Synonyms | ARHGAP1; Rho GTPase activating protein 1; rho GTPase-activating protein 1; Cdc42GAP; CDC42GAP; p50rhoGAP; RhoGAP; |
Gene ID | 392 |
mRNA Refseq | NM_004308 |
Protein Refseq | NP_004299 |
MIM | 602732 |
Uniprot ID | Q07960 |
Chromosome Location | 11p11.2 |
Pathway | Regulation of CDC42 activity, organism-specific biosystem; Regulation of RAC1 activity, organism-specific biosystem; Rho GTPase cycle, organism-specific biosystem; Signal Transduction, organism-specific biosystem; Signaling by Rho GTPases, organism-specific biosystem; |
Function | GTPase activator activity; Rac GTPase activator activity; Rho GTPase activator activity; SH3 domain binding; SH3/SH2 adaptor activity; |
◆ Recombinant Proteins | ||
ARHGAP1-2058HFL | Recombinant Full Length Human ARHGAP1 Protein, C-Flag-tagged | +Inquiry |
ARHGAP1-387R | Recombinant Rhesus monkey ARHGAP1 Protein, His-tagged | +Inquiry |
ARHGAP1-373H | Recombinant Human ARHGAP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ARHGAP1-216R | Recombinant Rhesus Macaque ARHGAP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ARHGAP1-9812H | Recombinant Human ARHGAP1, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARHGAP1-8745HCL | Recombinant Human ARHGAP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ARHGAP1 Products
Required fields are marked with *
My Review for All ARHGAP1 Products
Required fields are marked with *
0
Inquiry Basket