Recombinant Human ARHGAP1

Cat.No. : ARHGAP1-26235TH
Product Overview : Recombinant fragment of Human ARHGAP1 with a N terminal proprietary tag; Predicted MWt 36.63 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Molecular Weight : 36.630kDa inclusive of tags
Tissue specificity : Ubiquitous.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : GFLNIDESQRVPATLQVLQTLPEENYQVLRFLTAFLVQISAHSDQNKMTNTNLAVVFGPNLLWAKDAAITLKAINPINTFTKFLLDHQGELFPSPDPSGL
Sequence Similarities : Contains 1 CRAL-TRIO domain.Contains 1 Rho-GAP domain.
Gene Name ARHGAP1 Rho GTPase activating protein 1 [ Homo sapiens ]
Official Symbol ARHGAP1
Synonyms ARHGAP1; Rho GTPase activating protein 1; rho GTPase-activating protein 1; Cdc42GAP; CDC42GAP; p50rhoGAP; RhoGAP;
Gene ID 392
mRNA Refseq NM_004308
Protein Refseq NP_004299
MIM 602732
Uniprot ID Q07960
Chromosome Location 11p11.2
Pathway Regulation of CDC42 activity, organism-specific biosystem; Regulation of RAC1 activity, organism-specific biosystem; Rho GTPase cycle, organism-specific biosystem; Signal Transduction, organism-specific biosystem; Signaling by Rho GTPases, organism-specific biosystem;
Function GTPase activator activity; Rac GTPase activator activity; Rho GTPase activator activity; SH3 domain binding; SH3/SH2 adaptor activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ARHGAP1 Products

Required fields are marked with *

My Review for All ARHGAP1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon