Recombinant Human ARD1 protein, GST-tagged

Cat.No. : ARD1-741H
Product Overview : Human ARD1 full-length ORF ( AAH00308, 1 a.a. - 235 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : N-alpha-acetylation is among the most common post-translational protein modifications in eukaryotic cells. This process involves the transfer of an acetyl group from acetyl-coenzyme A to the alpha-amino group on a nascent polypeptide and is essential for normal cell function. This gene encodes an N-terminal acetyltransferase that functions as the catalytic subunit of the major amino-terminal acetyltransferase A complex. Mutations in this gene are the cause of Ogden syndrome. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Jan 2012]
Molecular Mass : 51.59 kDa
AA Sequence : MNIRNARPEDLMNMQHCNLLCLPENYQMKYYFYHGLSWPQLSYIAEDENGKIVGYVLAKMEEDPDDVPHGHITSLAVKRSHRRLGLAQKLMDQASRAMIENFNAKYVSLHVRKSNRAALHLYSNTLNFQISEVEPKYYADGEDAYAMKRDLTQMADELRRHLELKEKGRHVVLGAIENKVESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSAS
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name NAA10 N(alpha)-acetyltransferase 10, NatA catalytic subunit [ Homo sapiens ]
Official Symbol NAA10
Synonyms NAA10; N(alpha)-acetyltransferase 10, NatA catalytic subunit; ARD1, ARD1 homolog A, N acetyltransferase (S. cerevisiae) , ARD1 homolog, N acetyltransferase (S. cerevisiae) , ARD1A; N-alpha-acetyltransferase 10; DXS707; TE2; ARD1 homolog A, N-acetyltransferase; N-acetyltransferase ARD1, human homolog of; N-alpha-acetyltransferase 10, NatA catalytic subunit; N-terminal acetyltransferase complex ARD1 subunit homolog A; ARD1; NATD; ARD1A; FLJ78896; MGC71248;
Gene ID 8260
mRNA Refseq NM_001256119
Protein Refseq NP_001243048
MIM 300013
UniProt ID P41227

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All NAA10 Products

Required fields are marked with *

My Review for All NAA10 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon