Recombinant Full Length Human NAA10 Protein, C-Flag-tagged
Cat.No. : | NAA10-2029HFL |
Product Overview : | Recombinant Full Length Human NAA10 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | N-alpha-acetylation is among the most common post-translational protein modifications in eukaryotic cells. This process involves the transfer of an acetyl group from acetyl-coenzyme A to the alpha-amino group on a nascent polypeptide and is essential for normal cell function. This gene encodes an N-terminal acetyltransferase that functions as the catalytic subunit of the major amino-terminal acetyltransferase A complex. Mutations in this gene are the cause of Ogden syndrome. Alternate splicing results in multiple transcript variants. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 26.3 kDa |
AA Sequence : | MNIRNARPEDLMNMQHCNLLCLPENYQMKYYFYHGLSWPQLSYIAEDENGKIVGYVLAKMEEDPDDVPHG HITSLAVKRSHRRLGLAQKLMDQASRAMIENFNAKYVSLHVRKSNRAALHLYSNTLNFQISEVEPKYYAD GEDAYAMKRDLTQMADELRRHLELKEKGRHVVLGAIENKVESKGNSPPSSGEACREEKGLAAEDSGGDSK DLSEVSETTESTDVKDSSEASDSAS myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Glycerophospholipid metabolism, Limonene and pinene degradation, Phenylalanine metabolism, Tyrosine metabolism |
Full Length : | Full L. |
Gene Name | NAA10 N-alpha-acetyltransferase 10, NatA catalytic subunit [ Homo sapiens (human) ] |
Official Symbol | NAA10 |
Synonyms | TE2; ARD1; NATD; ARD1A; ARD1P; OGDNS; hARD1; DXS707; MCOPS1 |
Gene ID | 8260 |
mRNA Refseq | NM_003491.4 |
Protein Refseq | NP_003482.1 |
MIM | 300013 |
UniProt ID | P41227 |
◆ Recombinant Proteins | ||
NAA10-3237H | Recombinant Human NAA10 protein(Met1-Ser235), His&GST-tagged | +Inquiry |
Naa10-4266M | Recombinant Mouse Naa10 Protein, Myc/DDK-tagged | +Inquiry |
NAA10-553H | Recombinant Human NAA10, None tagged | +Inquiry |
NAA10-26531TH | Recombinant Human NAA10, His-tagged | +Inquiry |
NAA10-1470H | Recombinant Human NAA10 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NAA10-001HCL | Recombinant Human NAA10 cell lysate | +Inquiry |
NAA10-002HCL | Recombinant Human NAA10 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NAA10 Products
Required fields are marked with *
My Review for All NAA10 Products
Required fields are marked with *
0
Inquiry Basket