Recombinant Human APOLD1 Full Length Transmembrane protein, His-tagged

Source :	In vitro E. coli expression system
Species :	Human
Tag :	His
Form :	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass :	33.4 kDa
Protein length :	1-279aa
AA Sequence :	MFRAPCHRLRARGTRKARAGAWRGCTFPCLGKGMERPAAREPHGPDALRRFQGLLLDRRGRLHGQVLRLREVARRLERLRRRSLVANVAGSSLSATGALAAIVGLSLSPVTLGTSLLVSAVGLGVATAGGAVTITSDLSLIFCNSRELRRVQEIAATCQDQMREILSCLEFFCRWQGCGDRQLLQCGRNASIALYNSVYFIVFFGSRGFLIPRRAEGDTKVSQAVLKAKIQKLAESLESCTGALDELSEQLESRVQLCTKSSRGHDLKISADQRAGLFF
Purity :	Greater than 85% as determined by SDS-PAGE.
Storage :	Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution :	Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Name	APOLD1 apolipoprotein L domain containing 1 [ Homo sapiens ]
Official Symbol	APOLD1
Synonyms	APOLD1; apolipoprotein L domain containing 1; apolipoprotein L domain-containing protein 1; DKFZP434F0318; FLJ25138; vascular early response gene protein; VERGE; FLJ95166; DKFZp434F0318;
Gene ID	81575
mRNA Refseq	NM_001130415
Protein Refseq	NP_001123887
MIM	612456
UniProt ID	Q96LR9