Recombinant Human APOLD1 protein, GST-tagged
Cat.No. : | APOLD1-717H |
Product Overview : | Human APOLD1 full-length ORF (BAG37017.1, 1 a.a. - 248 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | APOLD1 is an endothelial cell early response protein that may play a role in regulation of endothelial cell signaling and vascular function (Regard et al., 2004 [PubMed 15102925]).[supplied by OMIM, Dec 2008] |
Molecular Mass : | 53.68 kDa |
AA Sequence : | MGMERPAAREPHGPDALRRFQGLLLDRRGRLHGQVLRLREVARRLERLRRRSLVANVAGSSLSATGALAAIVGLSLSPVTLGTSLLVSAVGLGVATAGGAVTITSDLSLIFCNSRELRRVQEIAATCQDQMREILSCLEFFCRWQGCGDRQLLQCGRNASIALYNSVYFIVFFGSRGFLIPRRAEGDTKVSQAVLKAKIQKLAESLESCTGALDELSEQLESRVQLCTKSSRGHDLKISADQRAGLFF |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | APOLD1 apolipoprotein L domain containing 1 [ Homo sapiens ] |
Official Symbol | APOLD1 |
Synonyms | APOLD1; apolipoprotein L domain containing 1; apolipoprotein L domain-containing protein 1; DKFZP434F0318; FLJ25138; vascular early response gene protein; VERGE; FLJ95166; DKFZp434F0318; |
Gene ID | 81575 |
mRNA Refseq | NM_001130415 |
Protein Refseq | NP_001123887 |
MIM | 612456 |
UniProt ID | Q96LR9 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All APOLD1 Products
Required fields are marked with *
My Review for All APOLD1 Products
Required fields are marked with *
0
Inquiry Basket