Recombinant Human APOLD1 protein, GST-tagged

• Cat.No.: APOLD1-717H
• Product Overview: Human APOLD1 full-length ORF (BAG37017.1, 1 a.a. - 248 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: APOLD1 is an endothelial cell early response protein that may play a role in regulation of endothelial cell signaling and vascular function (Regard et al., 2004 [PubMed 15102925]).[supplied by OMIM, Dec 2008]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 53.68 kDa
• AA Sequence: MGMERPAAREPHGPDALRRFQGLLLDRRGRLHGQVLRLREVARRLERLRRRSLVANVAGSSLSATGALAAIVGLSLSPVTLGTSLLVSAVGLGVATAGGAVTITSDLSLIFCNSRELRRVQEIAATCQDQMREILSCLEFFCRWQGCGDRQLLQCGRNASIALYNSVYFIVFFGSRGFLIPRRAEGDTKVSQAVLKAKIQKLAESLESCTGALDELSEQLESRVQLCTKSSRGHDLKISADQRAGLFF
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: APOLD1 apolipoprotein L domain containing 1 [ Homo sapiens ]
• Official Symbol: APOLD1
• Synonyms: APOLD1; apolipoprotein L domain containing 1; apolipoprotein L domain-containing protein 1; DKFZP434F0318; FLJ25138; vascular early response gene protein; VERGE; FLJ95166; DKFZp434F0318
• Gene ID: 81575
• mRNA Refseq: NM_001130415
• Protein Refseq: NP_001123887
• MIM: 612456
• UniProt ID: Q96LR9