Recombinant Human APOL3 protein, GST-tagged
Cat.No. : | APOL3-713H |
Product Overview : | Human APOL3 full-length ORF ( NP_055164.1, 1 a.a. - 331 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Description : | This gene is a member of the apolipoprotein L gene family, and it is present in a cluster with other family members on chromosome 22. The encoded protein is found in the cytoplasm, where it may affect the movement of lipids, including cholesterol, and/or allow the binding of lipids to organelles. In addition, expression of this gene is up-regulated by tumor necrosis factor-alpha in endothelial cells lining the normal and atherosclerotic iliac artery and aorta. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2015] |
Source : | Wheat Germ |
Species : | Human |
Tag : | GST |
Molecular Mass : | 62.9 kDa |
AA Sequence : | MDSEKKRFTEEATKYFRERVSPVHLQILLTNNEAWKRFVTAAELPRDEADALYEALKKLRTYAAIEDEYVQQKDEQFREWFLKEFPQVKRKIQESIEKLRALANGIEEVHRGCTISNVVSSSTGAASGIMSLAGLVLAPFTAGTSLALTAAGVGLGAASAVTGITTSIVEHSYTSSAEAEASRLTATSIDRLKVFKEVMRDITPNLLSLLNNYYEATQTIGSEIRAIRQARARARLPVTTWRISAGSGGQAERTIAGTTRAVSRGARILSATTSGIFLALDVVNLVYESKHLHEGAKSASAEELRRQAQELEENLMELTQIYQRLNPCHTH |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | APOL3 apolipoprotein L, 3 [ Homo sapiens ] |
Official Symbol | APOL3 |
Synonyms | APOL3; apolipoprotein L, 3; apolipoprotein L3; APOLIII; CG12 1; CG12_1; apoL-III; apolipoprotein L-III; TNF-inducible protein CG12-1; CG121; |
Gene ID | 80833 |
mRNA Refseq | NM_145640 |
Protein Refseq | NP_663615 |
MIM | 607253 |
UniProt ID | O95236 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All APOL3 Products
Required fields are marked with *
My Review for All APOL3 Products
Required fields are marked with *
0
Inquiry Basket