Recombinant Human APOH protein, GST-tagged

Cat.No. : APOH-710H
Product Overview : Human APOH full-length ORF ( AAH26283.1, 1 a.a. - 345 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Apolipoprotein H has been implicated in a variety of physiologic pathways including lipoprotein metabolism, coagulation, and the production of antiphospholipid autoantibodies. APOH may be a required cofactor for anionic phospholipid binding by the antiphospholipid autoantibodies found in sera of many patients with lupus and primary antiphospholipid syndrome, but it does not seem to be required for the reactivity of antiphospholipid autoantibodies associated with infections. [provided by RefSeq, Jul 2008]
Molecular Mass : 64.7 kDa
AA Sequence : MISPVLILFSSFLCHVAIAGRTCPKPDDLPFSTVVPLKTFYEPGEEITYSCKPGYVSRGGMRKFICPLTGLWPINTLKCTPRVCPFAGILENGAVRYTTFEYPNTISFSCNTGFYLNGADSAKCTEEGKWSPELPVCAPIICPPPSIPTFATLRVYKPSAGNNSLYRDTAVFECLPQHAMFGNDTITCTTHGNWTKLPECREVKCPFPSRPDNGFVNYPAKPTLYYKDKATFGCHDGYSLDGPEEIECTKLGNWSAMPSCKASCKVPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFWKTDASDVKPC
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name APOH apolipoprotein H (beta-2-glycoprotein I) [ Homo sapiens ]
Official Symbol APOH
Synonyms APOH; apolipoprotein H (beta-2-glycoprotein I); B2G1; beta-2-glycoprotein 1; beta 2 glycoprotein I; BG; B2GPI; apo-H; beta(2)GPI; APC inhibitor; anticardiolipin cofactor; activated protein C-binding protein; B2GP1;
Gene ID 350
mRNA Refseq NM_000042
Protein Refseq NP_000033
MIM 138700
UniProt ID P02749

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All APOH Products

Required fields are marked with *

My Review for All APOH Products

Required fields are marked with *

0

Inquiry Basket

cartIcon