Recombinant Human APOH protein, GST-tagged

• Cat.No.: APOH-710H
• Product Overview: Human APOH full-length ORF ( AAH26283.1, 1 a.a. - 345 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: Apolipoprotein H has been implicated in a variety of physiologic pathways including lipoprotein metabolism, coagulation, and the production of antiphospholipid autoantibodies. APOH may be a required cofactor for anionic phospholipid binding by the antiphospholipid autoantibodies found in sera of many patients with lupus and primary antiphospholipid syndrome, but it does not seem to be required for the reactivity of antiphospholipid autoantibodies associated with infections. [provided by RefSeq, Jul 2008]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 64.7 kDa
• AA Sequence: MISPVLILFSSFLCHVAIAGRTCPKPDDLPFSTVVPLKTFYEPGEEITYSCKPGYVSRGGMRKFICPLTGLWPINTLKCTPRVCPFAGILENGAVRYTTFEYPNTISFSCNTGFYLNGADSAKCTEEGKWSPELPVCAPIICPPPSIPTFATLRVYKPSAGNNSLYRDTAVFECLPQHAMFGNDTITCTTHGNWTKLPECREVKCPFPSRPDNGFVNYPAKPTLYYKDKATFGCHDGYSLDGPEEIECTKLGNWSAMPSCKASCKVPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFWKTDASDVKPC
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: APOH apolipoprotein H (beta-2-glycoprotein I) [ Homo sapiens ]
• Official Symbol: APOH
• Synonyms: APOH; apolipoprotein H (beta-2-glycoprotein I); B2G1; beta-2-glycoprotein 1; beta 2 glycoprotein I; BG; B2GPI; apo-H; beta(2)GPI; APC inhibitor; anticardiolipin cofactor; activated protein C-binding protein; B2GP1
• Gene ID: 350
• mRNA Refseq: NM_000042
• Protein Refseq: NP_000033
• MIM: 138700
• UniProt ID: P02749