Recombinant Human ApoE4 Protein

• Cat.No.: APOE-07H
• Product Overview: Recombinant Human ApoE4 Protein (1-199, Truncated ApoE, methionine in -1 position) without tag was expressed in E. coli.

Specification

• Description: The protein encoded by this gene is a major apoprotein of the chylomicron. It binds to a specific liver and peripheral cell receptor, and is essential for the normal catabolism of triglyceride-rich lipoprotein constituents. This gene maps to chromosome 19 in a cluster with the related apolipoprotein C1 and C2 genes. Mutations in this gene result in familial dysbetalipoproteinemia, or type III hyperlipoproteinemia (HLP III), in which increased plasma cholesterol and triglycerides are the consequence of impaired clearance of chylomicron and VLDL remnants.
• Source: E. coli
• Species: Human
• Form: Lyophilized
• Molecular Mass: 22.9 kDa
• Protein length: 1-199
• AA Sequence: MKVEQAVETEPEPELRQQTEWQSGQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVRGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKRLAVYQAGAREGAERGLSAIRERLGPLVEQGRVRAATVGSLA
• Purity: 95% by Chromatography and SDS-PAGE
• Storage: Store at -20 centigrade upon arrival.
• Dilutions: ApoE is soluble in PBS.

Gene Information

• Gene Name: APOE apolipoprotein E [ Homo sapiens (human) ]
• Official Symbol: APOE
• Synonyms: APOE; apolipoprotein E; AD2; LPG; APO-E; ApoE4; LDLCQ5; apolipoprotein E; apolipoprotein E3
• Gene ID: 348
• mRNA Refseq: NM_000041
• Protein Refseq: NP_000032
• MIM: 107741
• UniProt ID: P02649