Recombinant Human ApoE4 Protein

Cat.No. : APOE-06H
Product Overview : Recombinant Human ApoE4 Protein (1-162, Truncated ApoE, methionine in -1 position) without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : The protein encoded by this gene is a major apoprotein of the chylomicron. It binds to a specific liver and peripheral cell receptor, and is essential for the normal catabolism of triglyceride-rich lipoprotein constituents. This gene maps to chromosome 19 in a cluster with the related apolipoprotein C1 and C2 genes. Mutations in this gene result in familial dysbetalipoproteinemia, or type III hyperlipoproteinemia (HLP III), in which increased plasma cholesterol and triglycerides are the consequence of impaired clearance of chylomicron and VLDL remnants.
Source : E. coli
Species : Human
Form : Lyophilized
Molecular Mass : 19.2 kDa
Protein length : 1-162
AA Sequence : MKVEQAVETEPEPELRQQTEWQSGQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVRGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKRLAVY
Purity : 95% by Chromatography and SDS-PAGE
Storage : Store at -20 centigrade upon arrival.
Dilutions : ApoE is soluble in PBS.
Gene Name APOE apolipoprotein E [ Homo sapiens (human) ]
Official Symbol APOE
Synonyms APOE; apolipoprotein E; AD2; LPG; APO-E; ApoE4; LDLCQ5; apolipoprotein E; apolipoprotein E3
Gene ID 348
mRNA Refseq NM_000041
Protein Refseq NP_000032
MIM 107741
UniProt ID P02649

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ApoE4 Products

Required fields are marked with *

My Review for All ApoE4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon